KEGG   Shewanella putrefaciens CN-32: Sputcn32_1051Help
Entry
Sputcn32_1051     CDS       T00513                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00030  Pentose phosphate pathway
spc01100  Metabolic pathways
spc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputcn32_1051
Enzymes [BR:spc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sputcn32_1051
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Sputcn32_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C
Motif
Other DBs
NCBI-ProteinID: ABP74779
UniProt: A4Y496
Position
complement(1174537..1176903)
Genome map
AA seq 788 aa AA seqDB search
MTHIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRPFIYLVGPGHGFPAVQANLFLEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDSDAEED
IYVQMTNAMDTAYSMINEIQTRARSGEDVVKPRWPVILMRTAKGWTGVSEYNGVKLEGNC
ESHQVIVNKCATDKGHLDALNNWLASYHFQELYHMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALSNPDLEKLCYGPEVPRGQRGFSMLKMGQWMRDAFKLNRDQNNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDISRDGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRARIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETQHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatccatgaaataaacgctctgaaaaagtacgtcagagcaacaaacttcctt
gccacatcacaaatttacctcaaacaaaatgtcttacataaacgtccactagcacactct
gacataaaaccacgcttactcggtcactggggaacatgtcctggtatcaactttgtttat
gccaacattaacagactcatcgttaaacataatcgtccattcatctatttagttggccct
ggtcacggtttcccagccgtacaagctaacctattcctcgaaggttccttaagccacttc
taccctgaaacgattccgtataacgaaactggtatcgaagatatctgtaaaaagttttca
gcagcctatggctatccttcacacgcgaacccagaagctccaggacagatccttgagggg
ggggaattaggctattcactttcagtaggttggggtgccgttctcgataatcctgaccta
atcgccactgttttgattggtgacggtgaatcagaaactggcccactcgccgcctcatgg
tatgcaaaccgtttagtatcaccggccaccaacggggccgtgcttccaatagtgcatatt
aatggttataaaatttctggtccaactcgtatggggcgcatgagccatgaagagctagat
cttgaattccgaggcttaggttatttccccatcattgttgacagtgacgcagaagaagat
atctatgtgcagatgacaaatgccatggatactgcttacagcatgatcaacgagattcaa
acccgagctcgtagtggtgaagatgtcgtcaaacctcgctggccagtgatcttgatgcgg
acagctaaaggttggacaggcgtgagcgaatacaatggtgtcaagctagagggcaattgc
gaatctcatcaagtcattgtgaataaatgtgcgactgacaaaggccaccttgatgcactc
aataactggctagccagttatcattttcaagagctttatcatatgaatgataaaggtgag
ctgatttttgatgccgatatctgctcattaatcccaccgaaacaacttgcctgtggccgc
caacacttaacctatggtggcgaagtagttagagctttatctaatcccgatcttgaaaaa
ctctgctacggtccagaagttccacgtggtcaacgtggtttttcaatgctgaaaatgggt
cagtggatgcgagatgcatttaagcttaaccgtgatcaaaataatctacgtatttttagt
ccagatgaaacctattcaaaccaattacaagcggtatttgaagaaacagatcgcgcatgg
cagtggccaatcgaaagctgggatgaagatatatcccgcgatggacgagtgattgaatta
ttatcagagaacttgcttttcggtatgttgcatggctatacagtaacgggacgacatggc
atgttcccaacttatgagtccttctcgcaggtcgtttcatccatggcagatcaatactgt
aagtatgtatatgcaagccaaggtgtccacttccgtaaaccactaccagcatgtaacgtc
gtgctatcttccctcttagagcgtcaagatcacaatggctactcacaccaaaacccttca
tttttaggggcaatgttagaaaaacatccaaaaattatttcggcttatttacctgctgat
gccaacagtactctcgtctatacagagcgcgcatttgccgaccgtgacaagctcaatatc
cttgttgcaggtaaaaaagaactccctcaatggttaagcctagaagaagcccgtaagcaa
gcaaaagacggtgttatggtatgggattttgcttctgacgagaatcccgatattgttctt
gcaggctgcggagactatgtcactcaagaatgtatggcatccttggtattaattcgggaa
ttattaccaagagcaagaattcgcttcgttagtgtaacggaattaagcagtgatggctta
ggtagccgtaagtttaaagaaaagccttggttaatggatgaaatatttactcaagataaa
ggagtagtatttaactatcatggttatccaaatacaattaaaaagttaatttttgattac
aaaggaagtcgccgttttagaattaaaggatatgaagaagaaggttcaacaaccacacca
ttcgatatgggcgttcgtaatggaacatcacgctatcaccttgttattgatatggcttat
aagttgttccaacaaggcgtaatagatgaaactcagcatgtttcaattaccacagatatg
ctgcagagacttgttgatcatcgcaactatattaaagcaaatggtgttgatccaatcgaa
attgaaaactgggtttggacacgttaa

DBGET integrated database retrieval system