KEGG   Shewanella putrefaciens CN-32: Sputcn32_1051Help
Entry
Sputcn32_1051     CDS       T00513                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:spc00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1174537..1176903)
Genome map
AA seq 788 aa AA seqDB search
MTHIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRPFIYLVGPGHGFPAVQANLFLEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDSDAEED
IYVQMTNAMDTAYSMINEIQTRARSGEDVVKPRWPVILMRTAKGWTGVSEYNGVKLEGNC
ESHQVIVNKCATDKGHLDALNNWLASYHFQELYHMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALSNPDLEKLCYGPEVPRGQRGFSMLKMGQWMRDAFKLNRDQNNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDISRDGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRARIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETQHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWVWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacacatccatgaaataaacgctctgaaaaagtacgtcagagcaacaaacttcctt
gccacatcacaaatttacctcaaacaaaatgtcttacataaacgtccactagcacactct
gacataaaaccacgcttactcggtcactggggaacatgtcctggtatcaactttgtttat
gccaacattaacagactcatcgttaaacataatcgtccattcatctatttagttggccct
ggtcacggtttcccagccgtacaagctaacctattcctcgaaggttccttaagccacttc
taccctgaaacgattccgtataacgaaactggtatcgaagatatctgtaaaaagttttca
gcagcctatggctatccttcacacgcgaacccagaagctccaggacagatccttgagggg
ggggaattaggctattcactttcagtaggttggggtgccgttctcgataatcctgaccta
atcgccactgttttgattggtgacggtgaatcagaaactggcccactcgccgcctcatgg
tatgcaaaccgtttagtatcaccggccaccaacggggccgtgcttccaatagtgcatatt
aatggttataaaatttctggtccaactcgtatggggcgcatgagccatgaagagctagat
cttgaattccgaggcttaggttatttccccatcattgttgacagtgacgcagaagaagat
atctatgtgcagatgacaaatgccatggatactgcttacagcatgatcaacgagattcaa
acccgagctcgtagtggtgaagatgtcgtcaaacctcgctggccagtgatcttgatgcgg
acagctaaaggttggacaggcgtgagcgaatacaatggtgtcaagctagagggcaattgc
gaatctcatcaagtcattgtgaataaatgtgcgactgacaaaggccaccttgatgcactc
aataactggctagccagttatcattttcaagagctttatcatatgaatgataaaggtgag
ctgatttttgatgccgatatctgctcattaatcccaccgaaacaacttgcctgtggccgc
caacacttaacctatggtggcgaagtagttagagctttatctaatcccgatcttgaaaaa
ctctgctacggtccagaagttccacgtggtcaacgtggtttttcaatgctgaaaatgggt
cagtggatgcgagatgcatttaagcttaaccgtgatcaaaataatctacgtatttttagt
ccagatgaaacctattcaaaccaattacaagcggtatttgaagaaacagatcgcgcatgg
cagtggccaatcgaaagctgggatgaagatatatcccgcgatggacgagtgattgaatta
ttatcagagaacttgcttttcggtatgttgcatggctatacagtaacgggacgacatggc
atgttcccaacttatgagtccttctcgcaggtcgtttcatccatggcagatcaatactgt
aagtatgtatatgcaagccaaggtgtccacttccgtaaaccactaccagcatgtaacgtc
gtgctatcttccctcttagagcgtcaagatcacaatggctactcacaccaaaacccttca
tttttaggggcaatgttagaaaaacatccaaaaattatttcggcttatttacctgctgat
gccaacagtactctcgtctatacagagcgcgcatttgccgaccgtgacaagctcaatatc
cttgttgcaggtaaaaaagaactccctcaatggttaagcctagaagaagcccgtaagcaa
gcaaaagacggtgttatggtatgggattttgcttctgacgagaatcccgatattgttctt
gcaggctgcggagactatgtcactcaagaatgtatggcatccttggtattaattcgggaa
ttattaccaagagcaagaattcgcttcgttagtgtaacggaattaagcagtgatggctta
ggtagccgtaagtttaaagaaaagccttggttaatggatgaaatatttactcaagataaa
ggagtagtatttaactatcatggttatccaaatacaattaaaaagttaatttttgattac
aaaggaagtcgccgttttagaattaaaggatatgaagaagaaggttcaacaaccacacca
ttcgatatgggcgttcgtaatggaacatcacgctatcaccttgttattgatatggcttat
aagttgttccaacaaggcgtaatagatgaaactcagcatgtttcaattaccacagatatg
ctgcagagacttgttgatcatcgcaactatattaaagcaaatggtgttgatccaatcgaa
attgaaaactgggtttggacacgttaa

DBGET integrated database retrieval system