KEGG   Shewanella putrefaciens CN-32: Sputcn32_1075Help
Entry
Sputcn32_1075     CDS       T00513                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sputcn32_1075
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sputcn32_1075
Enzymes [BR:spc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sputcn32_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1203560..1206262
Genome map
AA seq 900 aa AA seqDB search
MNKTFAATAILVALGLTACSDVPDAQVVNQAPKPAHASPASEVNAVSGALTQTQLQQLGD
TLTATYRVVTNIPDEQCNKALAEGRCFVAEIDFVPGIDIASHDWSIYFSQMRPVQSVQSD
EFTISHVKGDLYRIAPTAAFTGFSKGVKKTLRFRGELWQLSETDAMPNYYLVAEHLAPVL
IASTQVVQDPETKLEVRPYVEGYTDMVKQYRRTETDKLQPADAARLFINNQAVSEDAALA
TNAIIPTPQKVQVHGTDKAVSLAAGIKVDYQQLDPTLLTPSQVAAALARLARLGVAENDQ
GLAVKLQHSAGNEGSYQLDIKANEINIAAADAAGFSYALSSLASLVDVQDLRVNAMTIED
SPRYPFRGMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTD
IGSQRCHDLAENTCLLPQLGSGPFAESSVNGFYTKQDYIDIVKYAEARQVQVIPSMDMPG
HSRAAIKSMEARYRKLLAEDKAAEAKTYLLSDADDKTVYSSVQYYDDNTLNVCMESTYQF
VDKVIDEIAKLHQAAGQPLTRYHIGADETAGAWKQSPQCLAFVANNDKGVKSIDELGAYF
IERISNQLANKGIEAAGWSDGMSHVRPENMPAKVQSNIWDVIAHKGHSRANQQANLGWET
VLSNPEVLYFDFPYEADPKEHGYYWASRATNSHKVFSFMPDNLAANAEQWTDIQHQPFEA
DDRIKLDEAGKKVSGPREEGKAFSGLQGQIWSETIRSDDTAEYMIFPRLLMLAERAWHQA
AWEVPYQYQGAVYNQNSGAFTLAMREAQAKDWQQLANTLGHKEFIKLDKAGINYRVPTVG
AEIRDGKLFANIAYPGLKLEYRSLNGQWQAYQVGLAVTAPIEIRAIAADGIRKGRSLIVN
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacatttgccgcgaccgctatactcgtcgcacttggtttgactgcatgttca
gatgtgccagatgctcaggtagtaaatcaggctcccaaacctgcacatgcctcgcctgcc
agtgaggttaacgccgtttcaggtgcattaactcaaactcaattgcagcaattgggggat
accttaacagccacttaccgtgttgtgactaatattcccgatgagcaatgtaacaaagcg
ctggccgagggtcgctgctttgtggccgaaatcgattttgtgccgggaatcgatattgcc
agtcacgactggtcgatttacttcagccaaatgcgtccggtgcaatcggttcagagcgat
gaatttacaatctcccacgtaaagggcgacttataccgcattgcaccgactgcggctttt
accggttttagcaaaggtgtgaaaaagaccctgcgattccgtggtgagttatggcaattg
tcagaaactgatgccatgcctaattactacttagtggccgaacatttagcgccagtattg
attgcgagtactcaggtggtgcaagaccctgaaaccaaattagaagtgcgtccctatgtc
gaaggctacactgacatggtgaagcaatatcgccgcactgaaactgataaattgcaaccc
gctgatgcagcaaggttatttatcaataatcaagcagtaagcgaagatgccgcactagcg
actaatgctattattcctacgccgcaaaaagtgcaagtacatggcaccgataaagccgtg
tctttagctgcgggtattaaagttgattatcaacagcttgatccaacactgctgacgcca
agtcaagttgcggccgcattagcgcgtttagcccgtcttggagtggctgaaaacgatcaa
ggtctagcggttaaattgcagcatagtgcgggcaatgagggcagttatcagctcgatatc
aaggctaacgaaatcaacatcgccgcagccgatgctgccggtttttcctatgcgctatct
tcgctggcgagtttggttgatgtgcaagacttgcgagtcaatgcgatgacgatcgaagat
agtccacgttatccgtttcgtggtatgcatatcgatgtggcacgtaatttccacagcaaa
caattgttgctggatttgctcgaccaaatggcggcttataagctcaataaactgcattta
cacatggctgacgatgaaggttggcgactcgaaatcgacgggttacctgagctgaccgac
atcggtagtcaacgttgtcatgatcttgctgaaaatacctgtttgttaccgcaattgggc
agtggcccttttgcggagtcgagtgttaatggtttctatactaaacaagactatatcgac
atagtgaaatatgctgaggcgcgtcaagttcaagtgatcccatcgatggatatgccgggc
cacagccgagcggcaattaagtcgatggaggcgcgctaccgtaagttactcgccgaagat
aaagccgctgaggctaagacttatctactttcggatgcggacgataaaaccgtttattcc
tcggtgcagtattacgacgacaacacgctgaacgtatgcatggaatcgacctatcagttt
gtcgataaagtgattgatgagattgccaagttacatcaagccgccggtcagccattaact
cgttatcatatcggtgcggatgaaaccgctggcgcttggaagcaatcgccccagtgtttg
gcgtttgtggccaataacgacaagggcgtgaaatcaatcgacgaattaggcgcttacttt
attgagcgcatttcaaatcagttggcgaataaaggcattgaagcagcgggatggagcgat
ggcatgagccatgttcgccctgagaatatgcccgctaaggtacagtctaatatttgggat
gtgattgcccacaaaggtcattcgcgcgccaatcagcaggcgaatctcggctgggaaacc
gtactttctaatcctgaggtgttgtactttgacttcccctatgaggccgatcctaaagag
catggttattactgggcaagccgagcgaccaatagccataaagtctttagctttatgcct
gataatttagccgctaacgccgagcaatggaccgatattcaacatcagccattcgaagca
gatgacagaataaaactcgatgaggcgggtaaaaaagtctcgggtccaagggaagaaggc
aaagcttttagcggccttcaagggcagatctggagcgagacaattcgcagtgacgatact
gccgagtacatgatatttccacgtttgttgatgctggctgagcgtgcttggcatcaagcc
gcgtgggaagtgccttatcagtatcaaggcgctgtgtataaccaaaactccggagctttt
accttagccatgcgtgaggcacaggcaaaagattggcaacaactcgcgaatactttgggc
cacaaagagtttatcaagctagataaagcgggaattaattatcgcgtaccgacggtcggc
gctgagatccgtgacggtaaactgtttgccaatatcgcctatcccgggcttaaactcgaa
taccgtagtctcaatggccagtggcaagcttatcaagtgggattggcggtcactgcacca
attgagatcagagccattgcggccgatggtattcgtaaaggccgaagtttaatcgttaac
taa

DBGET integrated database retrieval system