KEGG   Shewanella putrefaciens CN-32: Sputcn32_1111Help
Entry
Sputcn32_1111     CDS       T00513                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1250012..1250515
Genome map
AA seq 167 aa AA seqDB search
MARIYISLGSNIEPVQHLQAGLQSLRECFGPLRLSSMYESEAVGFSGTNFLNMVASAETD
LNIATVVAQFKQIEQNHGRLVGAKKFSPRTLDLDLLLYDDIVCQIPVVLPRAEIVNNAFV
LWPLAELAPNLVHPLVHQTYAKLWNDYDKDSQRLWPVTFEWPCGLTF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatttacattagtttaggtagtaatattgagcccgttcagcatttgcaggca
gggttacagtcactcagagaatgctttggtccactcaggctttcttctatgtatgagagt
gaagcggttgggtttagtggcacaaattttttaaatatggtggcaagcgctgaaaccgat
ttgaatattgctacggtagttgcgcagtttaagcaaatcgagcaaaatcacggccgtctt
gttggtgcaaagaagttcagcccaagaacattagatttagatttgttactttatgatgac
atagtatgtcaaattccagtggtgttaccccgggccgagatagttaataacgcttttgta
ttgtggcctttagcggagttagctccaaatctcgttcaccccttagtccaccaaacctat
gcaaaattgtggaatgactacgacaaagattcacagcgactttggcctgtgacgtttgaa
tggccctgtgggctgacgttttaa

DBGET integrated database retrieval system