KEGG   Shewanella putrefaciens CN-32: Sputcn32_1189Help
Entry
Sputcn32_1189     CDS       T00513                                 

Definition
putative oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputcn32_1189
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputcn32_1189
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Sputcn32_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1332778..1334901
Genome map
AA seq 707 aa AA seqDB search
MSDKIGGWAGKVLRVNLTTNHIWYEPINKYYDYIGGMGIGYKILWDNHKDNITATDPDNI
IVFSAGPLTGSGVICTGRTTITSRSPVIEKHLIADGHFGGHFSPAMKFAGFDAIAIEGKA
SSPVWLKIVDDKVTIEPADALWGKGIFDTHAMIAQMMGPNAQVAAIGQAGENQVPLSVIM
TQGGHSAGGHGSVMGSKNCKGIGIIGTGSVKIVANNEKMRALDDHILGIIGANNNGVVPS
TPQSWAEYSAPISRWKARPGLKWGAADQEIELGEVPWNERNRIGFRTSMAESYIGVEYAN
KWMKRTGGCHSCPIRCFCELKVPELKSKYGRKTEHISNVCMGFLVPQYLMGTKNGTEAHA
MAGALGAHILDDYGIWCNYGSISHLFKFLKTKDMFKHLLPEDEFNSIPWALWDNQDPAFL
LDFYRRVAFKEGEISHMADGLYDLIKRWGLDGTNPALGYWDIHKESATKVFNKKTNAAVH
HASETAGQVGTLINVVFNRDAQCHSHINIVNSGLPHDMTVAIAEKKWGEGAFDKVNWYTP
INAAKIRFAKWSLVKNVLHDSLTLCNWMFPLLASPDKNRNYEGDSTIESQMFSLVTGIET
TEAELDFKAERVLHLHRALTVLQMNESNMREEHDVLSDWVYDLNPDKNFGDQGTIKMDRA
DMQKALDMFYEAFGWDIQTGAPTRATLNKFGLGFVADRLAAKGLLPS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaataggcgggtgggctggtaaagtcctaagagttaatttaacaactaat
catatatggtatgagccaatcaataaatattatgattatattggtggtatgggcatagga
tataaaattctatgggacaatcataaagacaatataacggcaactgaccctgataatatt
attgtattttccgcaggcccattaacgggttcaggtgttatttgtaccggacgaacaacc
attacttcccgtagtcccgtaattgaaaaacatctgattgctgatggccattttggtggg
catttttcacctgcgatgaaatttgcaggtttcgatgccattgccattgaaggcaaagcc
agcagccctgtgtggcttaaaattgtggatgataaggtcacgattgaacctgccgatgcc
ctatggggtaaaggcatatttgatacccatgcgatgatagcacaaatgatggggcctaat
gctcaggttgccgcaattggtcaagcaggggaaaaccaagtaccactttcagtgataatg
acgcaaggcgggcattcagcgggtggtcatggctctgttatggggtctaaaaattgtaaa
gggatcggtattattggtactggttcggtcaaaattgtcgctaacaatgaaaaaatgcgc
gcattagatgaccatattttagggattatcggcgccaataataatggtgttgtcccttca
acaccgcaatcttgggccgagtactcagcgcctatcagtcgttggaaggctagaccaggg
ctcaagtggggcgctgccgatcaagaaattgaattaggtgaagtgccatggaacgaacgt
aaccgtatcggtttccgtacttcgatggctgaaagttatattggcgtggaatatgccaat
aaatggatgaagcgaactggtggctgtcattcatgccctattcgctgtttctgtgaactt
aaagtccctgaacttaagagtaaatacggccgcaaaaccgaacacatatccaacgtctgt
atgggattccttgtaccacagtatttaatgggcaccaaaaatggtacagaagcacacgcg
atggcgggcgctttaggggcacatattctcgatgactatggtatttggtgtaactatgga
tctatttctcatctatttaaattcttaaaaacaaaggatatgtttaagcatttattacct
gaggatgaatttaacagtattccttgggcactttgggataaccaagatccggctttctta
cttgatttttatcgccgagtggcgtttaaagaaggtgaaatctcccacatggctgacggc
ttatatgatttgattaagcgttggggattagatggaaccaaccccgcattaggttactgg
gatatccacaaagaaagtgcaacgaaagtatttaacaagaaaaccaatgcagccgttcac
catgccagtgaaaccgcaggtcaggttggtacgttaattaacgtggtctttaaccgtgat
gcccagtgccattcccacatcaatatcgttaacagtggtttgccacatgatatgacagtg
gcgattgccgagaaaaaatggggtgaaggtgcattcgataaggtgaattggtatacccca
atcaatgcggccaagatccgttttgccaaatggtcgctggtgaaaaacgtgttacacgat
tcgctgacactgtgtaactggatgttcccattgttggcatcaccggataagaatcgtaac
tatgagggtgacagcactatcgaatcgcagatgtttagtttagtgacagggattgaaacc
actgaagctgaattggactttaaagcggaaagagtgctgcatttacaccgtgctttaacc
gtattgcaaatgaatgaaagcaatatgcgcgaagagcatgatgtgctcagtgattgggtt
tatgatttgaatccagataaaaactttggcgatcagggcaccatcaagatggatcgtgct
gatatgcaaaaagcactggatatgttctatgaagcctttggctgggatattcaaaccgga
gccccgactcgagcgacgctcaataagtttggcttagggtttgtagcagatagattagct
gcaaagggcttattaccgagttga

DBGET integrated database retrieval system