KEGG   Shewanella putrefaciens CN-32: Sputcn32_1238Help
Entry
Sputcn32_1238     CDS       T00513                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:spc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:spc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:spc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382530..1384257
Genome map
AA seq 575 aa AA seqDB search
MVIGDATALEVSVKPVNSGASWEGIKMTEHTLSEQQLNSTLGKAAPNATLDIVGPDIPGQ
EVIFTDGAVALLESLCREFAGEVPVLLAKRKEKQARIDKGGLPDFLPETRAIRDGAWQIR
GIPTDLLDRRVEITGPVERKMVINALNANAKVFMADFEDSLAPSWQKVVEGQINLRDAVR
GDIEYTAPETGKHYKLGPHPAVLICRVRGLHLKEKHVQFNGESIPGSLFDFALYFYHNYR
QLLAKGSGPYFYIPKLESHIEARWWAKVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDE
ILYELRSNIVALNCGRWDYIFSYIKTLKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCH
KRGALAMGGMAAFIPAKDPAQNEAVLQRVRRDKELEARNGHDGTWVAHPGLADTAMGIFN
EYIGQDHCNQLHITRDVDAPILAAELLKTCDGERTEQGMRLNIRIALQYLEAWISGNGCV
PIYGLMEDAATAEISRASIWQWIQHGKSLSNGKLVTKQLFKDMLVEELANVKEEVGSDRF
TSGKFTQAAVLLEDITTSDELVDFLTLPGYEMLTA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtggtgattggggatgctactgctttagaagtcagcgttaagcctgtgaatagtggagcc
tcttgggagggcatcaagatgacggaacacactttgagtgagcagcaattgaattcgaca
ctgggtaaagccgcaccaaacgcgacacttgatattgtggggcctgatattcctggacaa
gaggtgatttttaccgacggggctgtagccttactcgaatctctttgccgcgagtttgct
ggcgaggttcctgtgctacttgctaaacgtaaagaaaagcaagctcgcatcgataaaggg
ggattaccagacttcttacctgaaacccgtgctattcgggatggtgcgtggcaaatccgc
gggatcccaacagatcttctcgaccgtagagtcgaaattactggccccgttgaacgtaaa
atggtgatcaatgcgcttaatgctaacgcaaaagtatttatggccgatttcgaggactct
ttagcgccaagttggcaaaaagtggtagaaggccagattaacctgcgtgatgctgttcgt
ggtgatatcgaatataccgcgccagaaacaggtaaacattacaaacttggccctcatccg
gcagtacttatttgccgtgttcgcggcttacatttgaaagaaaagcatgtgcaatttaac
ggtgagtctattcctggttcactgttcgatttcgcactgtatttctatcacaactatcgc
caactcttagcaaagggtagtggtccatacttctatattcctaagttagaaagccatatt
gaagctcgctggtgggcaaaggtgtttgcttttgttgaggaaagattttgtcttcaagca
ggcacaatcaaatgtacttgcctgattgagactttgcctgccgtgttcgagatggacgaa
attctctatgaattgcggtctaatattgtggcgcttaattgtggccgttgggattacatt
ttcagctatatcaaaacattaaaacgccatagcgaccgagtgttacccgatcgtcaagct
gtcactatggatacacccttcttaagtgcttattcaagactcctgattaagacctgccac
aaacgcggtgctttagcgatgggcggtatggcagcctttattccagcaaaagatcccgct
cagaacgaagcagtattgcagcgggttcgtcgggacaaagagcttgaggcgcgtaatggc
cacgatggtacttgggtcgcccatcccggtcttgctgataccgcgatggggatttttaac
gaatatataggtcaagatcattgtaatcaattacatattacccgtgatgtagatgctccc
attctagcggctgagttacttaaaacctgcgatggtgagcgtactgagcaaggtatgcgt
cttaatattcgtattgcgttgcagtatttagaggcgtggattagtggcaatggctgtgta
cctatttatggtttgatggaggacgcggctaccgccgaaatttctagagcctcaatttgg
caatggatccaacatggtaagtcactctctaatggcaagcttgtgactaagcagctcttc
aaggacatgttggtggaagaactcgcgaatgtgaaggaagaagtgggaagtgacagattt
accagtggcaaattcacccaagcggcggtgttactggaagatattactacctctgatgag
ttggtcgatttcttaactttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system