KEGG   Shewanella putrefaciens CN-32: Sputcn32_1239Help
Entry
Sputcn32_1239     CDS       T00513                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputcn32_1239
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sputcn32_1239
Enzymes [BR:spc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sputcn32_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1384392..1385714
Genome map
AA seq 440 aa AA seqDB search
MTKATQNSRQEQIDTIKKDWAENPRWKNVRRPYTAEEVVKLRGSIVPENTIAKRGAAKLW
ELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPA
NSVPAVVSRINNSFRRADQIQWGNGVNPEDEAFVDYFLPIIADAEAGFGGVLNAFELMKS
MIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTD
ANAADLLTSDCDPYDRDFVTGERTTEGFYRVRAGLDQAISRGLAYAPYADLIWCETAKPD
LEEARIFAEAIHAKYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLAG
IHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTV
IQGGHSSVTALTGSTEEEQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgcagaattcacgtcaagagcagattgatacaatcaaaaaagactgg
gcagaaaacccacgttggaaaaatgtgcgtcgtccttatacggcggaagaagtagtgaaa
ctgcgcggttctattgtgccagaaaacactatcgcaaagcgtggtgcggctaagttatgg
gaattagtcaatggcggggcaaaaaaaggctatgtgaattcacttggtgcattaaccggt
ggtcaagcggtgcaacaagccaaggcgggtatcgaagcgatttacctttcaggttggcaa
gtggctgcggatgctaacttagccggtactatgtatccagatcaatctttataccctgct
aactcagttccggctgtggtatcacggattaataattctttccgccgtgcagatcaaatc
caatggggtaatggtgtcaatccagaagatgaagcatttgtagattatttcctgccgatc
attgccgatgccgaagccggctttggtggtgtattaaatgcatttgaactgatgaaatcg
atgatcgatgcaggcgctgccggtgttcattttgaagatcagttagcgtcagtgaagaaa
tgtggtcacatgggcggcaaagtattagtaccaacccaagaggcggtacagaagttagtc
gccgcccgtttagcggcagatgtgagcggtgtagaaaccttggttattgcccgtacggat
gcgaacgcagccgatttgctgacttcagattgtgacccatacgatcgtgatttcgtcact
ggagaacgtactactgaaggtttctatcgggttagagccggccttgaccaagcgatttct
cgcggtttagcctatgcgccgtacgccgatttgatttggtgtgaaaccgccaagccagat
ttagaagaggcgcgaattttcgccgaagcgattcatgctaagtacccagatcaactgctc
gcctataactgttcaccgtctttcaattggaagaaaaacttagatgatgccactatcgcg
cgcttccaacaggcgttgtcagacatgggttataagtaccagttcatcacgttagctggt
attcataacatgtggtacaacatgtttgatttagcttacgactatgctcgtggcgaaggc
atgaagcactatgttgagaaagttcaagaagttgagtttgctgcggccaagaagggttat
accttcgttgcccaccagcaggaggtcggtactggttatttcgaccaagtgacgacggtt
attcaaggtggtcattcatcggttaccgcgctgactggctctaccgaagaagagcagttt
taa

DBGET integrated database retrieval system