KEGG   Shewanella putrefaciens CN-32: Sputcn32_1247Help
Entry
Sputcn32_1247     CDS       T00513                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1392868..1395105
Genome map
AA seq 745 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQYIRISETDRQGILTCMLLDNASTDGDPQFASAAQALLS
DESIAQQIYELDALPWTQVLPEFQWCFVDEPWISLYLPYSYKTDINITIHCEDGESILLN
VPFSTLKVIGDYRIPEAQGERQYIQYRLDLIEYGVKNNTLYTQTDMADEGLNHFPVLGLG
YHTITFVLPPTALVSHDLLEAQVFHGTLMVAPRTTYQGVLSTAIQGKRHKPWGVSIQLYS
LRSETQWGIGDFGDLEALITLVATQGADFIQLNPLHALDIAAPEHSSPYSPCDRRRLNPL
YIHMQSVPEYELLATEFASSSWQEAIHALHQDNWLNYPKISDLKYRAFARLYCLFCEKHL
ALQTPRAKHFHDFVAEQGAALLEFAEAECLRSPRAIVQDAGFYLYLQFVAQSQLALCQLK
AKEAGMGIGLIRDLAVGAALHGVEVQANVAQFCLNVSIGAPPDPFAPQGQNWGLTPLDPI
KLKQDNFRHFIALMRANMGHCGALRIDHVMGLLRLWWWPLDKNLGKGAYVYYPVETLLAI
VCLESQRARCVVIGEDLGLVPPDIIHRLYNAGIYGNELFYFCRDHQGFKAPSQYKPQSLM
MLANHDVPTLVAWWNGSDLHLRRQLSLFETDDQLASALAERAHEKQQLLSLLVHQGLLGE
RSVQEIDIPSLLTAWMTLGASGNSALYSVQWCDLLADSYAVNIPGTWLEYPNWQRHLPQG
IEQAAKMPELLQRLQHIAAARQLPH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttgctgtatttgcgaggggttggagcagagtttacggattgcttt
ggccagtatatccgcatttctgaaaccgatagacaaggcattctaacgtgcatgttgctg
gataatgcctctactgatggcgatccccagttcgcatctgctgcgcaggcgttattgagt
gatgagtcaatcgcacaacaaatttatgagcttgatgcgcttccttggacccaagtgttg
cctgagtttcaatggtgttttgtcgatgaaccttggataagcctttatcttccatatagt
tacaaaactgatatcaatatcactattcattgtgaggatggagagtcgatcctattaaat
gtgccattttctacactgaaagtgattggagattatcggatcccagaggctcaaggagaa
cgtcagtatatacaatatcgacttgatctcattgagtatggtgtcaaaaacaacacactt
tacactcaaacagacatggccgatgaaggactcaatcatttcccagtattgggtttaggt
taccatacaattacttttgtattaccgccaacggcgcttgtcagtcatgatcttttagag
gctcaggtattccatggcacgctaatggtggcgccacgtacgacatatcaaggcgtgcta
agtactgctatccaaggaaaacgccataaaccatggggcgtgagtattcaactttacagt
ttacgtagtgaaacccaatggggaataggtgactttggtgatcttgaagcgcttatcact
ttagttgcaacacagggcgctgattttattcaacttaacccattgcatgcccttgatatt
gccgcacctgaacactcaagcccatacagtccttgcgatcgccgtagactcaatcctctc
tatattcatatgcaaagcgtacccgagtacgagttactcgccacagagtttgcttcatcg
agctggcaagaggcgattcatgcactacatcaagataattggcttaattaccctaaaata
agcgatctgaaataccgagcttttgctcgtttatattgcctattctgtgaaaagcattta
gcactacaaacccccagagcaaaacatttccatgactttgtggctgagcagggcgctgca
ctgctggaatttgccgaagcggaatgtcttagaagtccaagggcaattgtgcaggacgca
ggattttatctgtacttacaatttgtcgcacaaagtcagttagcactttgccaattaaaa
gcgaaagaagcgggaatggggattggcctcattcgcgatcttgccgttggcgccgcactt
catggcgtagaagttcaagccaatgtggcgcaattttgtttgaatgtgagcataggtgca
ccgcctgatccctttgcaccacaagggcaaaattggggactaacgccattagatcctatc
aaactcaaacaagataattttcggcattttatcgcgcttatgcgcgccaacatgggacat
tgcggcgcactgcgaattgatcatgtgatgggattgctgcgtttatggtggtggccgctg
gataaaaatttaggtaagggtgcctatgtttattaccccgttgaaaccttgcttgctatt
gtttgccttgaaagccaacgagcccgttgtgtcgtgattggggaagatttagggctagtg
cctcctgatattattcatcgactctataacgcaggtatttacgggaatgagttgttttat
ttttgccgcgaccatcagggttttaaagctcccagtcagtacaaaccccaaagtttaatg
atgcttgccaatcacgatgtgcccactttagtcgcttggtggaatggcagtgatttgcac
ctgaggcggcaattatctctgtttgaaaccgacgatcaattagccagtgccttagctgaa
cgagcgcatgaaaaacagcaattactttctcttttagtgcaccaaggcctattaggtgaa
agaagtgttcaggagatagacataccaagcttattaacagcatggatgaccttgggggct
tcgggtaacagtgcgctttacagcgtgcaatggtgcgatttgttagccgatagctatgcg
gtcaatattccagggacttggctcgaataccctaattggcaaaggcatttaccccaaggg
attgagcaggcggcaaagatgccagagctcctgcagcggctacaacatatcgccgctgct
aggcagttgcctcactaa

DBGET integrated database retrieval system