KEGG   Shewanella putrefaciens CN-32: Sputcn32_1354Help
Entry
Sputcn32_1354     CDS       T00513                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sputcn32_1354
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sputcn32_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1534217..1535398
Genome map
AA seq 393 aa AA seqDB search
MVILGATGSIGASTLSVISANPLAYCVYGLVANASVDKMLALCITHQPKVAHMVDAVAAK
ALRAQLPAALNIQVTTGNDELLALVTSSKVDTVMAAIVGAAGLVPTLAAVNAGKRVLLAN
KEALVMSGELFIEATKRSGATLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHILLT
GSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQAN
QLKVVVHPQSVIHSMVQYIDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFKVGQ
LSFYEPDFERFPCLALAMAACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNETCL
AFVPSGTMTSIEDIIALDTQSRIYARETLAKIA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtgattctgggtgcgacaggctcgattggcgccagtaccttaagtgtgatttcggct
aatccattggcttattgcgtttatggcttagtggctaatgcgagtgtggataaaatgctg
gcattatgcattacccaccaacctaaagttgctcatatggtcgatgctgtcgcggcaaag
gcattacgagctcagcttcctgctgcgcttaatatccaagtgacaacgggtaacgatgag
cttctggcgttagtgacctcatcaaaggtcgataccgttatggcggccattgttggcgct
gctgggttagttccgacgcttgctgccgttaatgcgggcaaacgagtattgctagccaat
aaagaagccttagttatgtcgggtgagttgtttatcgaggcgactaagcgttcaggcgca
actttactgcctgtagacagcgaacataatgcgatttttcaatgtttaccccaagaggta
caggctaatcttggtcgttgtgatttagccgcatccggtatttcccatattctgctaacg
ggttctggtggaccatttttacgttcagatttagcaacacttgcggccatgacacccgca
caggcctgtaaacatcctaattggtctatgggacctaaaatctctgtcgattcggcgact
atgatgaataagggattagagttcattgaggcgcgctggttgtttaatacgcaagctaac
caacttaaagtggttgttcatccgcagagtgttatccattcaatggtgcaatatattgat
ggctctgttattgcacaaatgggaaaccctgacatgcggacaccgattgcccattgcatg
gcctatccacaaagaattcactctggtgttgaacctttagattttttcaaagtcggacag
ttaagcttttatgaacctgattttgagcgttttccctgtttggcgctggctatggcagcc
tgtgcccaaggccaagaggcgacaacggtactcaatgcggcgaatgagatcgcggttgag
gcttttttacaaggacaaataggctttacgcaaattgctaaagtgaatgaaacttgctta
gcattcgtcccgagtggaactatgaccagcattgaagatattatcgcgttagatacgcaa
agtcgcatttatgcgcgggaaactttagctaagatcgcttaa

DBGET integrated database retrieval system