KEGG   Shewanella putrefaciens CN-32: Sputcn32_1354Help
Entry
Sputcn32_1354     CDS       T00513                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00900  Terpenoid backbone biosynthesis
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sputcn32_1354
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sputcn32_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ABP75082
UniProt: A4Y549
Position
1534217..1535398
Genome map
AA seq 393 aa AA seqDB search
MVILGATGSIGASTLSVISANPLAYCVYGLVANASVDKMLALCITHQPKVAHMVDAVAAK
ALRAQLPAALNIQVTTGNDELLALVTSSKVDTVMAAIVGAAGLVPTLAAVNAGKRVLLAN
KEALVMSGELFIEATKRSGATLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHILLT
GSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQAN
QLKVVVHPQSVIHSMVQYIDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFKVGQ
LSFYEPDFERFPCLALAMAACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNETCL
AFVPSGTMTSIEDIIALDTQSRIYARETLAKIA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtgattctgggtgcgacaggctcgattggcgccagtaccttaagtgtgatttcggct
aatccattggcttattgcgtttatggcttagtggctaatgcgagtgtggataaaatgctg
gcattatgcattacccaccaacctaaagttgctcatatggtcgatgctgtcgcggcaaag
gcattacgagctcagcttcctgctgcgcttaatatccaagtgacaacgggtaacgatgag
cttctggcgttagtgacctcatcaaaggtcgataccgttatggcggccattgttggcgct
gctgggttagttccgacgcttgctgccgttaatgcgggcaaacgagtattgctagccaat
aaagaagccttagttatgtcgggtgagttgtttatcgaggcgactaagcgttcaggcgca
actttactgcctgtagacagcgaacataatgcgatttttcaatgtttaccccaagaggta
caggctaatcttggtcgttgtgatttagccgcatccggtatttcccatattctgctaacg
ggttctggtggaccatttttacgttcagatttagcaacacttgcggccatgacacccgca
caggcctgtaaacatcctaattggtctatgggacctaaaatctctgtcgattcggcgact
atgatgaataagggattagagttcattgaggcgcgctggttgtttaatacgcaagctaac
caacttaaagtggttgttcatccgcagagtgttatccattcaatggtgcaatatattgat
ggctctgttattgcacaaatgggaaaccctgacatgcggacaccgattgcccattgcatg
gcctatccacaaagaattcactctggtgttgaacctttagattttttcaaagtcggacag
ttaagcttttatgaacctgattttgagcgttttccctgtttggcgctggctatggcagcc
tgtgcccaaggccaagaggcgacaacggtactcaatgcggcgaatgagatcgcggttgag
gcttttttacaaggacaaataggctttacgcaaattgctaaagtgaatgaaacttgctta
gcattcgtcccgagtggaactatgaccagcattgaagatattatcgcgttagatacgcaa
agtcgcatttatgcgcgggaaactttagctaagatcgcttaa

DBGET integrated database retrieval system