KEGG   Shewanella putrefaciens CN-32: Sputcn32_1385Help
Entry
Sputcn32_1385     CDS       T00513                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1572912..1573820)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDDASCNLSKDNLAAMVELFDETQVGQIMVEGVPHNMVNQYGI
ADVNGHDLQPGESEPLVELVEKPPVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAHYLKNVVKG
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttcccgcgaccaaagctattcccaaggaaatgctacccgttgttgataagccattgatt
cagtatgtcgtcagtgaagctattgcggctgggatcaaagaaattgtactcgtaactcat
gccagtaaaaactccatcgaaaaccatttcgataccagttttgaattagaagcccagcta
gaacgccgtgtaaagcgtcaactgctagaagctgttcagtctatttgtcctaaagatgta
actgtgatcagtgttcgccaatcccaggctaaaggtttaggtcatgctattttatgtgcc
aaatccgttgtaggtgacgctccttttgccgtattgctacctgacgtcatcatcgatgat
gcaagttgcaacctcagcaaagacaacttggctgcgatggttgagctttttgatgagacg
caagtgggccagatcatggttgaaggtgtgccacacaacatggtcaaccaatacggtatt
gccgatgtgaatggccatgatttacaaccaggtgaatctgaaccattagtcgaactggta
gaaaaaccaccagtagatgaagcgccttctaacttagccgttgttggtcgttatgtatta
cctgccagcatctggccattactggctaaaacacctgcaggtgcgggcgatgaaatccaa
ttaacggatgcgattgcgatgttaatgaagcaagaaaccgtaaatgcttactacatggaa
ggtaagagccacgactgcggtaacaaacaaggttatatgcgtgctaacgttgaatatgcc
ctgcgccacagcgagatcggtgaagattttgcgcactatttaaaaaacgttgtaaaagga
attaaataa

DBGET integrated database retrieval system