KEGG   Shewanella putrefaciens CN-32: Sputcn32_1741Help
Entry
Sputcn32_1741     CDS       T00513                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
spc  Shewanella putrefaciens CN-32
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1988290..1989315)
Genome map
AA seq 341 aa AA seqDB search
MSRELLQTAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNSALNEQLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDTHEFQSRIESNFEKL
HRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCLNRRAFDADFSGMLTQAPEGTCVILVDIDHFKVFNDSYGHQMGDQVLRAVAKR
LQESCRDGIKLYRFGGEEFAILVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERIDNIS
ASFGVAQWQEKQTGLQLIEKADKLLYEAKRLGRNRVMPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagaattattacaaaccgccgcattaaatttaaaaaaagccgttccgctaatg
ctcaaacataaaattcccacgacacctgtgaattatgcactctggtacacctatgtcggg
gagcaaaattcagcattaaatgagcagcttgatactgttatcgcgcaatacaatacctgt
ccgccagtgagtagtgagttgctctaccgccaatatgtagccgatcccgtcgaattggac
gtacgagaaatgcgccaaaatttagatgccatggtgactgagctttcgcaatcgctcaaa
gacaccaatcttgatacccatgagtttcaatcccgtatcgagagcaattttgagaaactc
catcgtattgaagatgaaggttttagtgtcgagcaagtactcgatttagtgcggagttta
gtaaaagaatccgacaatattcgttctagcactgaatttttcaccggacaattacaaaag
gcacaaacggaaatcgatgcccttaagaaaaaactcgaacaaacggaaaaagatgtactt
tacgatgcgctcacagggtgccttaaccgccgcgcatttgatgccgacttcagcggtatg
ctaacccaagctcccgaagggacttgcgtcattttggtcgatatcgatcactttaaagtg
tttaacgactcctatggtcaccaaatgggcgatcaggtattgcgtgccgttgctaagcgc
ttacaagaatcctgccgtgatggaattaaactgtaccgctttggcggtgaagagttcgcc
attctcgtgcctaaaagccaattacgcattgcccgtcaattggctgaagccatgcgccga
gggcttgaaaagctcagcttaaaagacagacgtaaagatgaacgcatcgataatatcagt
gcctcttttggtgtcgcgcaatggcaagaaaaacaaacagggcttcaactgattgaaaag
gcggataagttactctatgaagccaaacgactcggccgtaatcgggtgatgccaataagt
aactag

DBGET integrated database retrieval system