KEGG   Shewanella putrefaciens CN-32: Sputcn32_2060Help
Entry
Sputcn32_2060     CDS       T00513                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2354124..2355179)
Genome map
AA seq 351 aa AA seqDB search
MSLSISTQKLTHSAFPAPLELITLTNSHGLEVVLSSYGASIWSVKLYGKEDKTIDLSLSY
QNIQDWAINPYYFGITAGRVANRIGGAAFSLKGQTIVLTPNEGNNQLHGGPQGLSHCVWQ
CETKQYSDAVGAIFRIQSPDGDQGYPGDLSVTVEYRLSESNELTLIYDALSDQTTPVCLT
NHAYWNLASDKQHGILGHNLQLNASHILALDSEQIPTGELVLVDDTPFDFRQIKSISEDI
HKLSNGYDHYFVMSKDIDNTSCLKTIATLIEPISGRELEISTTELGVQFYSGNFLDGTRL
DNHGKPLNQYQGLCLETHGYPNAVNIAHFPSVMLEANKPYKQITVHRFKNI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctcaatctctacacaaaaattaacacatagtgcctttcctgcaccattagag
ttaataacattaacgaatagtcatggtttggaagtagtgttatcgagttatggtgcaagt
atttggtctgtcaaactctatggaaaagaagataaaaccattgatctcagtttgagttat
cagaatattcaagattgggcaataaatccttattattttggtattactgcaggccgcgtt
gcaaatcgaattggtggagcggcattttctttaaagggtcaaaccattgtattaaccccg
aatgaaggtaataaccaacttcacggtggtccgcaaggcttaagtcactgtgtttggcaa
tgtgaaactaagcaatattccgatgctgttggtgccatctttagaatacagagtcctgat
ggtgatcaaggttatcctggggatttatccgtaacagtcgaatatcgccttagcgaaagc
aatgagttgaccctaatttacgatgcactctctgaccaaaccactccggtttgtctcaca
aatcatgcctattggaatctcgcatctgacaagcaacatggcatcttaggccataactta
caactcaatgcgagtcatattttagccttagattctgagcaaattcctacgggtgaattg
gttttagtcgatgatacccccttcgattttcgtcaaataaaatccatatctgaagatatt
cataaattaagtaatggttatgaccactattttgtgatgtcgaaggatatagacaatacc
tcatgcttaaaaaccatcgccacattaatcgaacctatttcaggacgtgaattggaaatc
agtaccacagaattaggcgtgcaattttatagtggtaattttttggatggtacgcggctt
gataatcatggaaaaccgttaaatcaatatcaaggtttatgtttagaaacccatggttat
cctaatgccgtcaatattgctcattttccgagtgttatgttagaggcaaataaaccctat
aaacaaataacggtgcatagatttaaaaatatttaa

DBGET integrated database retrieval system