KEGG   Shewanella putrefaciens CN-32: Sputcn32_2096Help
Entry
Sputcn32_2096     CDS       T00513                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
spc  Shewanella putrefaciens CN-32
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2402272..2403378)
Genome map
AA seq 368 aa AA seqDB search
MLPHIQIRSVELTYVIQKINNNMVSIFMFSVENKELDSAAQILRLAVPQMSALDIPVTPE
NYTVWYEYFAGTNLDLNRAIDGFIANGVVFTKEVNTSLYKNFIQEQSPEVIENVQIETQI
LINSLLCKIVQLNQGTADFSGTLAEFGIKLQSNSDINTLNQLVDGVMDEMQSLLINNQNM
EQSLNAMGQEVQHLKSEMENLSLAAMTDQLTSLYNRRAYEIAIQDHIHRAQEQHSRCSLL
IVDIDRFKQFNDTYGHQIGDKVLAYVALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDA
LQVAETLRERISERHLTIGKDKKLSLGAITVSIGLASLQEGDDAETLFSRADKALYEAKS
DGRNCVRG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccatatccaaattcgatcagttgagctaacttatgttatacaaaaaattaac
aataatatggtttcaatatttatgttttctgttgaaaataaagaacttgattccgcggcg
caaattttgcggctagccgtgccacaaatgtcggcccttgatatccccgttaccccggaa
aactatacggtttggtatgaatattttgcggggactaatcttgacttaaaccgtgcgatt
gatggttttatcgcaaacggtgttgtgtttacaaaagaggttaatacaagcttatataaa
aattttatccaagaacaatcccccgaggtgattgagaatgtgcaaatagagactcagatt
ttaatcaattcattactgtgcaaaattgtacaattgaaccaagggaccgcggatttttcg
ggcactttagcggaatttggcatcaagcttcaatccaattctgacattaataccttaaat
caacttgttgatggtgtgatggatgaaatgcaaagtttactgatcaacaaccaaaacatg
gaacaaagcctaaatgccatggggcaagaggtacaacatcttaagtcggaaatggaaaat
ttaagtctggcggccatgacggatcaattaacctctttatataatcgccgcgcctatgaa
attgccattcaagaccatattcaccgcgcccaagaacagcattcccgttgtagcttactg
attgttgatatagataggtttaaacaatttaatgatacctatggtcatcaaattggcgat
aaagtattagcttatgtcgcactcgccttaaagcaatgtgttcgaggtgatgactttgtt
gctcgctatggtggcgaagagtttgtagtgcttttgcctaatacccattttcacgatgct
ttacaagttgcggaaaccttaagagaacgtatttcagagcggcacttaaccataggtaaa
gataaaaaattatccctcggcgcaattacagtatcgatcggtcttgcctcattacaagag
ggtgatgatgccgaaacgctctttagccgagcggataaagccttatatgaagctaaatcc
gatgggcgtaactgtgttaggggatag

DBGET integrated database retrieval system