KEGG   Shewanella putrefaciens CN-32: Sputcn32_2112Help
Entry
Sputcn32_2112     CDS       T00513                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sputcn32_2112
Enzymes [BR:spc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sputcn32_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2428719..2430779
Genome map
AA seq 686 aa AA seqDB search
MMRSTFGLNAHAHSAEHWVDYGAIQLTAPLADLLKQWEQERLITSLDRHFALQMSQLHQG
DSQNPLFILLCALLSQQLSSQHSCLVLAHIVPLNPMAEQVSHCKITLSLDELTSILQTFD
AVGQAGSNKPLIIENGRLYLQRYHQFETAVATSLIQLSAQTNTVKVEDLKSHLDQLFPAN
NAEIIDWQKVATATALGKKLAIITGGPGTGKTTTVTKLLLLLQLESNQTIRLVAPTGKAA
ARLSESIKASKARLAKELSLNQSDNSQAIFLTALSRIPEEASTLHRLLGVIPNSPQFRHH
QGNPLRLDLLIVDEASMVDLPMMYKLLNALPEHASLILLGDQDQLASVEAGAVLADICAG
LKLPMPQGGTQESLWQMRYSLEQATQLSILTGYDLTPFISQSPKMGDSLCMLMHSHRFKG
DAGIGLLASAVNRADLQGILQVWRQGFAELNWLEHSTHLSQTQAKVSEPAHNTGLNLLLE
QACAQYGDYLGLLNQDIGNRPSTAEIIERFNHYRILCAMRSGDYGVEGINSYVTQALTHA
KLIKPQQEFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGGLLKVLP
ARLPKHETCYAMTVHKSQGSEFNRVALVLPPSPSLAQWQLLTKELIYTAITRAKAHFTCL
GSQQVFERASSQVTQRASGLADRLWG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctcaacattcggcttaaatgcgcacgctcattcagcggagcattgggttgac
tatggcgccatccaacttacggcgccactagctgatttactcaaacagtgggagcaagag
cgattgataacatcgctcgatcggcattttgcactacaaatgagtcagttacatcagggt
gatagccaaaatcccctgtttatcttactctgtgcgctgttgagccaacagttatcttca
cagcatagttgcttagtacttgcccatatcgtgcctctcaaccccatggcagagcaagtc
agtcattgtaaaatcacattaagccttgatgaattaactagcattctgcaaacctttgat
gccgtgggccaagctggcagcaataaacccctgattatcgaaaatggcagactctactta
cagcgttatcatcagtttgaaactgctgttgccacctcgttaattcaattatccgcacaa
accaatactgtaaaagttgaggatcttaaaagtcacttagatcagttattccctgccaac
aatgccgaaataattgattggcaaaaagtggcaacggccaccgcgcttggcaaaaagctg
gcgattatcaccggtgggcctggcacaggtaaaaccacaacggtgactaagctattatta
ttgttgcaattggaatcaaaccaaacgatccgcttagtcgctcctacgggaaaagccgcg
gcgcgcttaagtgaatccattaaggcctcaaaagcccgccttgcgaaagaactgagcctt
aatcaaagcgacaatagccaagcgatatttttaaccgcactcagccgaataccagaagag
gcctctactttacaccgactacttggggtcattcctaattcacctcagtttcgccaccat
caaggtaatccgttaaggctcgacttattgatcgtggatgaagcctcgatggtagattta
cctatgatgtataagttgttaaatgccctaccagagcatgccagtttgattttactgggg
gatcaagatcagttggcttccgttgaagcgggtgctgtacttgccgatatttgtgcaggt
ttaaaactgcctatgccgcaaggaggtacacaagaatcactttggcaaatgcgctattcg
ctcgaacaggccacacagctcagtatattgacaggctatgacttaacaccatttatcagc
cagtcccccaaaatgggcgatagtttatgtatgttaatgcatagccataggttcaaaggg
gatgcgggcataggactccttgcaagtgcagttaatcgcgctgatcttcaagggattcta
caggtgtggcgccaaggatttgcggagcttaactggttagaacacagtactcacctgagc
caaacccaagcaaaagtcagtgaaccggcacacaacactgggcttaacttactgcttgaa
caagcatgcgcacaatatggcgattacctcggtttattaaatcaggatatagggaatcgt
cctagcaccgcagaaattatcgagcgttttaaccactaccggattttatgcgccatgcgc
tcgggtgattatggggtagaaggtattaacagctatgtcacccaagcgctcacccatgcc
aaacttatcaaaccacaacaggagttttatttaggccgcccgattattatccaaagtaat
gactataacttaggcttgtttaacggggatatcggactaattctacaggatgaagataaa
cccgaacgcctaatggcacactttattaaggccgacggtggtctgcttaaagtcttaccc
gcacgtttaccaaagcatgaaacctgctacgcgatgacagtgcataaaagccaagggagt
gaattcaatcgcgtggctttggtgctaccaccgagtccaagcctagctcagtggcaacta
ttaactaaagaattaatttatacagcaattacccgcgcgaaagcacattttacttgctta
ggctcccagcaagtttttgagcgagccagcagccaagtcacccaaagggcatcgggtctt
gccgatagactttggggttaa

DBGET integrated database retrieval system