KEGG   Shewanella putrefaciens CN-32: Sputcn32_2123Help
Entry
Sputcn32_2123     CDS       T00513                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00300  Lysine biosynthesis
spc01100  Metabolic pathways
spc01120  Microbial metabolism in diverse environments
spc01230  Biosynthesis of amino acids
Module
spc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sputcn32_2123
Enzymes [BR:spc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sputcn32_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABP75844
UniProt: A4Y7B1
Position
2440476..2441615
Genome map
AA seq 379 aa AA seqDB search
MTAEHFPVTELAKDLISRPSVTPLDEGCQTLMAERLSAIGFNIEPMIFEDTTNMWARRGN
QGPVFCFAGHTDVVPTGDISRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVT
KHPDHQGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVKNG
RRGSLTGNLTIKGIQGHVAYPHLADNPIHKAAPFLAELSQMHWDNGNEFFPPTSMQIANI
HGGTGASNVIPGALEVMFNFRYSTEVTAEILIERVEALLKAHELDYDISWIFNGLPFLTG
EGPLLDATRYAIHQVTGYDTSPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECVKV
DDLEQLALCYEVILEQLLC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgaacattttccggtcaccgaacttgctaaagacctgatttcacgcccttca
gtcactccactcgatgaaggctgtcaaacattaatggcagaaagactgagcgctatcggt
tttaatatcgaacccatgatatttgaagacaccaccaatatgtgggcacgccgtggcaac
caaggcccagttttttgttttgcaggtcacaccgatgtggtacccactggggatataagc
cgctggcatacaccaccatttgaacccaccattatcgatggttatctgtatggccgtggc
gccgcggatatgaaaggttccctcgctgccatgatcgtggcgaccgaacgttttgtgaca
aaacatcctgatcaccaaggctctatcgcctttttaattaccagtgacgaagaaggtcca
tttattaatggcaccactcgggtgattgataccctagaagcgcgcaatgaaaaaatcact
tgggcactggtgggcgaaccttcctcaaccctcaagttaggcgatgtcgtcaaaaatggt
cgtcgtggcagtctcaccggcaatttaaccatcaaagggattcaaggccatgtggcttac
cctcatcttgctgataatcctatccataaagcggcccctttcttagcggagctaagccaa
atgcattgggataacggcaacgaattcttcccccccaccagcatgcaaatcgccaatatt
cacggtggtacaggcgcatcgaacgtgatccccggcgccttagaggtgatgtttaacttc
cgttactcgacagaagtgactgccgagatccttatcgagcgggtagaagccttattaaaa
gcccatgaacttgattatgatataagctggatattcaatggattaccatttttgactggc
gagggtcccctactcgatgccacgcggtacgctattcaccaagtgacgggttatgacacc
tcaccacaaaccactggtggcacgtccgatggtcgttttattgcacctacgggcgctaaa
gttttagagttaggtccagtaaatgcgaccattcataaagtgaatgaatgtgtaaaagtg
gatgatcttgaacaactcgcgctgtgttatgaagtgattttggaacagctactgtgctaa

DBGET integrated database retrieval system