KEGG   Shewanella putrefaciens CN-32: Sputcn32_2179Help
Entry
Sputcn32_2179     CDS       T00513                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spc01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:spc00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2507274..2508575
Genome map
AA seq 433 aa AA seqDB search
MEILTWSTLSAAEQKTALKRSPLIGDSGLEQSVRAILDAVATRGDAAIAEFNQKFDGFDS
AKIGELRMGETEIAAASARVSPELKAAIAKAMANIDVFHSAQQFRPIDMETEAGVRCELR
SEPIEKVGLYIPGGSAPLISTVMMLALPAKIAGCEQRVLVSPPPINDAIIYAANACGITE
IYQVGGAQAIAALAFGTETIPAVDKIFGPGNRYVTEAKRLVSQDGRCTVCIDMPAGPSEV
LVIADSDANCEFIAADLLSQAEHGPDSQVILVTDSQDIADGVNDALTRQLAALPRCDIAA
TALLSSRTFVVDDMLQAAQVSNQYGPEHLIIQTRFPREVLKNIRAAGSVFLGAYTPESIG
DYASGTNHVLPTYGYSRAVSSLSLADFSRRFTVQELSAKGLIGLGQAVMTLASNELLDAH
KNAVAIRLASLEK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaacttggtcaaccttatccgccgccgagcagaaaacggcgctaaaacgc
tcgcccttaattggtgatagtggcttagagcaaagcgttcgcgccattctcgatgcggta
gcgacgcggggtgatgccgccattgccgaatttaatcaaaagtttgatggctttgatagt
gctaagattggtgagctgcgcatgggcgaaaccgaaattgccgcggcaagtgcacgagta
tcgcctgagctaaaagcggcgatcgccaaagccatggcgaacatagacgtgtttcacagc
gcccagcaatttcgcccgattgatatggagaccgaggcgggagtacgctgtgagctacgt
agcgaaccaattgaaaaagtaggtttatatattccaggtggcagcgcaccattaatttct
accgtgatgatgctcgccctgcccgccaagatcgccggctgcgaacaaagagtattagtc
agcccaccgcccatcaacgatgccattatctatgcagccaatgcctgtgggatcactgag
atctatcaagtaggcggcgcgcaggccattgcggcactggcatttggcacagaaactatt
cccgcggtcgataagatttttggccctggtaatcgctacgtgacagaagctaaacgctta
gtatcacaggatggccgctgcactgtgtgtatcgatatgccagctggtccttctgaggta
ttagtgattgccgatagcgacgctaattgcgaatttattgccgccgatttgctttcgcaa
gcggagcacggccctgattcacaagtgattttagtaaccgattcgcaagatatcgccgat
ggcgtgaatgacgcgctaacaagacaactcgctgccctgccgcgttgtgatatcgcggca
acggcgctcctcagcagccgcacttttgttgtggacgatatgctacaagccgcgcaggtt
tccaatcaatatgggcctgaacacttgatcattcaaacgcgctttccacgtgaggtactg
aaaaacattcgcgccgcgggctcggtatttttaggcgcttatacacctgaatctattggt
gattatgccagtggcaccaaccacgtgctgccgacctacggttatagccgcgccgtgtcg
agcctgtcattagccgattttagccgccgctttaccgtgcaggaactcagcgctaagggc
ttaatcggattggggcaagcggtcatgacgttagccagtaacgaattgctcgatgcgcac
aaaaatgccgtcgccattcgtctagctagcctagaaaaatga

DBGET integrated database retrieval system