KEGG   Shewanella putrefaciens CN-32: Sputcn32_2235Help
Entry
Sputcn32_2235     CDS       T00513                                 

Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spc00230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:spc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2572589..2573959
Genome map
AA seq 456 aa AA seqDB search
MDLSALTAISPVDGRYGSKTASLRGIFSEFGLTKYRVQVEINWLKLLADCPEIIEVPPLS
ESAIAVLDGIKDNFNEQDALRVKAIESTTNHDVKAVEYFIKEKIAGNAELAAVGEFVHFA
CTSEDINNLSHGLMLTEAREQVLLPYCNELLTAIKKLAIEYRSVPLMSRTHGQPASPSTL
GKEMANVAVRLERQIKQIANVEIMGKLNGAVGNYNAHLSAYPEVNWHELSERFVTSLGLN
WNAYTTQIEPHDYIAELFDAVARFNTVLIDFDRDIWGYIALGHFKQRTIAGEIGSSTMPH
KVNPIDFENSEGNLGIANALMQHLASKLPVSRWQRDLTDSTVLRNLGVGIAHALIAYQAT
LKGISKLEVNEAHLRDELDHNWEVLAEPVQTVMRRYGIEKPYEKLKELTRGKRIDAQQLS
VFIDGLELPDSVKAELKKMTPANYIGRAETFVDELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatctttccgcactaactgctatctctccggtagacggccgttatggtagtaaaacc
gcgtcattgagagggattttcagcgagttcggtcttaccaagtaccgtgttcaggttgaa
atcaattggttaaaactgttagccgattgcccagaaatcatcgaagtaccaccgctaagc
gagtcagctatcgccgtgctcgatggcattaaagacaatttcaacgaacaagatgcgctg
cgtgttaaggctatcgaaagcaccactaaccacgatgtgaaagcggttgaatacttcatc
aaagaaaaaatcgcgggcaatgccgaattagctgctgtgggtgagtttgttcactttgct
tgtacttccgaagatatcaacaacttaagccacggtttaatgttgactgaagcccgtgag
caagtcttactgccctactgcaacgagttgctgacggcaattaaaaagctggcgattgaa
tatcgctctgtgccattaatgtcacgtacccatggccaacccgcgtcaccttcgacgctc
ggtaaagaaatggcgaacgtcgcagtgcgccttgaacgtcaaatcaaacaaatcgccaat
gttgaaatcatgggcaaactgaacggtgccgtaggtaactacaatgctcacctgtcagcc
tatccagaagttaattggcatgaactgtctgagcgttttgtaacaagccttggccttaac
tggaatgcctacacgacgcaaatcgagccacacgattacattgccgaattgtttgatgcg
gttgcccgtttcaacactgtgctgattgactttgaccgtgatatttggggttacatcgcc
ctaggtcacttcaaacaacgcactatcgccggtgaaatcggttcatcgactatgccgcac
aaagttaaccccatcgattttgaaaattctgaaggtaacttaggtatcgctaacgcactg
atgcaacacttagcctctaagctaccagtttcaagatggcaacgtgacttaactgactcg
actgtactgcgtaacttaggtgtaggtattgcccatgcattgatcgcgtatcaagcgacc
ttaaaaggcatcagcaagttagaagttaacgaagcacatctgcgtgatgagttagatcac
aactgggaagtgttagcagaacccgtacaaacggtaatgcgtcgttatggcattgaaaag
ccatacgaaaaattaaaagaactgacgcgcggtaaacgtatcgacgcgcagcaactgtca
gtgtttattgacggacttgaattaccagactcagtgaaagctgaactgaagaaaatgacg
ccagccaattacattggtcgcgccgaaacgtttgtcgacgaactgaagtaa

DBGET integrated database retrieval system