KEGG   Shewanella putrefaciens CN-32: Sputcn32_2235Help
Entry
Sputcn32_2235     CDS       T00513                                 

Definition
adenylosuccinate lyase (EC:4.3.2.2)
Orthology
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sputcn32_2235
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sputcn32_2235
Enzymes [BR:spc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     Sputcn32_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2572589..2573959
Genome map
AA seq 456 aa AA seqDB search
MDLSALTAISPVDGRYGSKTASLRGIFSEFGLTKYRVQVEINWLKLLADCPEIIEVPPLS
ESAIAVLDGIKDNFNEQDALRVKAIESTTNHDVKAVEYFIKEKIAGNAELAAVGEFVHFA
CTSEDINNLSHGLMLTEAREQVLLPYCNELLTAIKKLAIEYRSVPLMSRTHGQPASPSTL
GKEMANVAVRLERQIKQIANVEIMGKLNGAVGNYNAHLSAYPEVNWHELSERFVTSLGLN
WNAYTTQIEPHDYIAELFDAVARFNTVLIDFDRDIWGYIALGHFKQRTIAGEIGSSTMPH
KVNPIDFENSEGNLGIANALMQHLASKLPVSRWQRDLTDSTVLRNLGVGIAHALIAYQAT
LKGISKLEVNEAHLRDELDHNWEVLAEPVQTVMRRYGIEKPYEKLKELTRGKRIDAQQLS
VFIDGLELPDSVKAELKKMTPANYIGRAETFVDELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggatctttccgcactaactgctatctctccggtagacggccgttatggtagtaaaacc
gcgtcattgagagggattttcagcgagttcggtcttaccaagtaccgtgttcaggttgaa
atcaattggttaaaactgttagccgattgcccagaaatcatcgaagtaccaccgctaagc
gagtcagctatcgccgtgctcgatggcattaaagacaatttcaacgaacaagatgcgctg
cgtgttaaggctatcgaaagcaccactaaccacgatgtgaaagcggttgaatacttcatc
aaagaaaaaatcgcgggcaatgccgaattagctgctgtgggtgagtttgttcactttgct
tgtacttccgaagatatcaacaacttaagccacggtttaatgttgactgaagcccgtgag
caagtcttactgccctactgcaacgagttgctgacggcaattaaaaagctggcgattgaa
tatcgctctgtgccattaatgtcacgtacccatggccaacccgcgtcaccttcgacgctc
ggtaaagaaatggcgaacgtcgcagtgcgccttgaacgtcaaatcaaacaaatcgccaat
gttgaaatcatgggcaaactgaacggtgccgtaggtaactacaatgctcacctgtcagcc
tatccagaagttaattggcatgaactgtctgagcgttttgtaacaagccttggccttaac
tggaatgcctacacgacgcaaatcgagccacacgattacattgccgaattgtttgatgcg
gttgcccgtttcaacactgtgctgattgactttgaccgtgatatttggggttacatcgcc
ctaggtcacttcaaacaacgcactatcgccggtgaaatcggttcatcgactatgccgcac
aaagttaaccccatcgattttgaaaattctgaaggtaacttaggtatcgctaacgcactg
atgcaacacttagcctctaagctaccagtttcaagatggcaacgtgacttaactgactcg
actgtactgcgtaacttaggtgtaggtattgcccatgcattgatcgcgtatcaagcgacc
ttaaaaggcatcagcaagttagaagttaacgaagcacatctgcgtgatgagttagatcac
aactgggaagtgttagcagaacccgtacaaacggtaatgcgtcgttatggcattgaaaag
ccatacgaaaaattaaaagaactgacgcgcggtaaacgtatcgacgcgcagcaactgtca
gtgtttattgacggacttgaattaccagactcagtgaaagctgaactgaagaaaatgacg
ccagccaattacattggtcgcgccgaaacgtttgtcgacgaactgaagtaa

DBGET integrated database retrieval system