KEGG   Shewanella putrefaciens CN-32: Sputcn32_2268Help
Entry
Sputcn32_2268     CDS       T00513                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00020  Citrate cycle (TCA cycle)
spc00310  Lysine degradation
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01120  Microbial metabolism in diverse environments
spc01130  Biosynthesis of antibiotics
spc01200  Carbon metabolism
Module
spc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sputcn32_2268
  Amino acid metabolism
   00310 Lysine degradation
    Sputcn32_2268
Enzymes [BR:spc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sputcn32_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABP75989
UniProt: A4Y7Q6
Position
complement(2610819..2612021)
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEHVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVAGQEVTKAQAEAAAPVAETSDESNDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVSSASKGAPKAAAPAAPAVAPLAEGRSEKRVPMTRLR
KTIANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYVKAVTEA
LKRFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMSLAEIEKAVRDLAIK
GRDGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgctacgattgcc
acttggcacgttaaagtgggtgagcatgtttctcgtgatcaaaatcttgttgatattgaa
acagataaagttgtactcgaagtggttgcacctgaagatggccacattggtgagtttctg
ttccaagagggcgataccgtacttggtgaacaagtgattgctaagttcatcgcgggggct
gttgctggtcaagaagtcactaaagctcaagctgaagcggcagcaccggttgctgaaaca
agtgatgaaagtaatgatgcgttaagtccatctgtacgccgtttactggcagagcacaat
gttgatgctagcaaagtgaaaggtacaggtgtaggcggtcgtatcactaaagaagacgtt
gaagcttttgttagctctgcatcaaaaggggcgcccaaagcagcagctcctgcagcacct
gccgttgcgccattagcagaaggccgtagtgagaaacgtgtacctatgacacgtttacgt
aaaactatcgctaaccgtctattagaagcgaaaaactctaccgctatgctcacgacgttc
aacgaagtgaacatgaagcccatcatggatatccgtaagcagtaccaagatatctttgaa
aagcgccacggcatccgtttaggttttatgtctttctatgtgaaagcggtgacagaagcc
ctgaaacgcttcccagaagtgaacgcatcaatcgatggtgatgatattgtttatcacaat
tatttcgatattagcattgctgtatcaacaccacgtggtctggtaacacctgtcttacgt
gacacagatactatgagccttgctgaaattgaaaaagcagtacgcgatctcgctatcaaa
ggccgtgatggcaaactgacggttgccgatatgactggtggtaacttcaccgtgactaac
ggcggcgttttcggttcactgatgtctacaccgatccttaacctgccacaaagtgcgatt
ttaggcatgcatgccattaaagatcgtccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctagcactctcatatgaccatcgtattgttgatggccgtgagtctgtt
ggtttcttggttgcgattaaagacttcctagaagacccaacacgtctgctgctcgatctt
taa

DBGET integrated database retrieval system