KEGG   Shewanella putrefaciens CN-32: Sputcn32_2406Help
Entry
Sputcn32_2406     CDS       T00513                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase / indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01130  Biosynthesis of antibiotics
spc01230  Biosynthesis of amino acids
Module
spc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sputcn32_2406
Enzymes [BR:spc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sputcn32_2406
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Sputcn32_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABP76127
UniProt: A4Y844
Position
2786819..2788297
Genome map
AA seq 492 aa AA seqDB search
MTQELITNSQDMRTQPQVETNPMPKSNVLTRIVDTKAAHIAALKLRFPEASLSPKISDRS
LFAALKAPKAGYILECKKASPSKGLIREVFDVEAIADIYGKYAAGISVLTDEQFFQGDMD
YIPKVRARVNQPILCKDFFVDEYQIKLAAHQGADAILLMLSVLDDAQYHRLAKEAAKYQL
DVLTEVSNEEELKRAIALDAPIIGINNRNLRDLSTDLATTEALAPHIGSDRVVISESGIY
NNEQVRRLSPLVDGFLVGSSIMAEADIDLACRKLIFGHNKVCGLTRMEDILAAATSGAVY
AGLIFAEKSPRALTLNAAEQLLKEYRASEAPAIEFVGVFVNAAPKTICDIAAKLQLSAVQ
LHGAETELEIAELTERLEQAGLTTQIWKAVSVDAQTGELGNLPQGASRYLFDSKTAGQFG
GSGQAFNWQSIDVKSLGPQKAYAMLAGGLNPGNAASANAQGFYGLDFNSGLETAAGIKSA
QLIQTAFANLRL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagaactgataacaaatagccaagatatgagaactcagccacaggtagaaaca
aaccctatgccaaaaagtaatgtgttaacccgtatagtcgataccaaagctgcccatatt
gccgccctgaagctgcgtttccccgaggccagtctgtcgccaaaaatctctgaccgcagt
ttgtttgccgcactcaaggcgcccaaggcgggttacattttagaatgtaaaaaagccagc
ccgtccaaagggcttatccgcgaggtgtttgatgtagaagccattgccgatatttacgga
aaatatgcggcgggtatttcagtattaaccgacgagcagtttttccaaggggatatggac
tatatccctaaggtgcgcgctcgggtgaaccaacctattctgtgcaaagatttttttgtc
gatgaataccaaattaaactcgccgcccaccaaggcgccgatgcaattttgctgatgcta
tccgtgctggatgatgcgcaatatcaccgcctagcgaaagaagccgctaagtatcaactc
gatgtgctgactgaagtcagtaacgaagaagaacttaaacgcgccatcgcattagatgcg
ccgatcattgggatcaataaccgtaacttaagggatttgagtaccgatctcgccaccaca
gaagccttagcgccacacattggtagcgaccgcgtggtgatcagcgaatcaggcatctac
aacaatgaacaagtgcgccgcctgagtccgctggttgatggcttcctcgtcggtagttcg
ataatggccgaggctgatattgacttagcctgccgtaaattgatcttcggtcacaataaa
gtctgcggcctcacccgcatggaagatattctcgccgcggcaacgtcaggcgccgtctat
gccgggctgatttttgctgaaaaatccccacgcgcgttaacccttaatgccgcagaacaa
ctactcaaggagtatcgcgcatccgaggctcccgccattgaatttgtcggcgtgtttgtt
aatgccgcgccaaaaaccatttgtgatatcgccgccaaattacagttatcggccgtacag
ctccatggcgcggaaactgaacttgaaatcgcagagctcaccgagcgacttgagcaagcg
ggactcacaactcaaatttggaaagccgtcagcgtcgatgcgcaaacgggtgagcttggt
aacttaccccagggagcatcgcgatatctctttgatagtaaaacggcaggccaatttggc
ggctcgggccaagcctttaattggcaaagcattgatgtgaaatccctcggcccacaaaag
gcctatgccatgttggctggcggactcaatccaggcaatgcagccagtgccaatgcccaa
ggattttacggtttagattttaattcaggcctagaaaccgcggcaggaattaaatcggcg
caactgatccaaacagcttttgccaacttacgtctctaa

DBGET integrated database retrieval system