KEGG   Shewanella putrefaciens CN-32: Sputcn32_2408Help
Entry
Sputcn32_2408     CDS       T00513                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00260  Glycine, serine and threonine metabolism
spc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spc01100  Metabolic pathways
spc01110  Biosynthesis of secondary metabolites
spc01130  Biosynthesis of antibiotics
spc01230  Biosynthesis of amino acids
Module
spc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sputcn32_2408
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sputcn32_2408
Enzymes [BR:spc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sputcn32_2408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ABP76129
UniProt: A4Y846
Position
2789606..2790442
Genome map
AA seq 278 aa AA seqDB search
MSDTLTNTGLYQAARYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADAL
ELGFPFSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFA
NGIDVFYAKAQQAGVDSVLIADVPVEESAPFSEGAKAHGIAPIFIAPPNADSETLEQVSK
SGEGYTYLLSRAGVTGTDTKAGVPVEEILSKLKAFNAPPPLLGFGIAEPSQVSAAIKAGA
AGAISGSAVVKIIETHQHDEVKLLATLGEFTRAMKAAT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacacaggcctttaccaagcggcccgttaccaagccaccttt
gccaaactcaaggccgaaggccggggcgcttttgtccccttcgtcacccttggcgatcct
agccctgagttatcgctaaaaattatcgataccttagtgcaaaacggcgccgatgcctta
gaactgggctttccgttttccgatcccttggccgatggcccagtgatccaaggcgctaac
ctgcgttctttagccgcaggcacgactccaacggcgtgttttgaattactggcgcaagtg
cgtgcaaaatatcctgaactgccaatcggtttgctgctgtatgcgaacttggtgtttgct
aacggcatagatgtgttttacgccaaagcgcagcaagcgggtgtggattcagtgcttatc
gccgatgtgccagtggaagaatccgcgccctttagcgaaggcgcaaaagcccatggtatt
gcgccgatttttatcgcgccgcccaatgccgacagtgaaacccttgagcaagtgagtaaa
agtggtgaaggttacacctatctcttatcccgcgcgggagtcacaggcacagacacgaaa
gctggcgtgccggtagaggaaattttatctaaattaaaagcctttaacgccccaccaccg
ctcctcggttttggtattgccgaaccttcacaggtaagtgccgccatcaaagcgggcgct
gcgggggcgatttctggctctgccgtagtaaaaatcatcgaaacccaccagcacgatgaa
gttaagctacttgcaacgcttggggaatttactcgcgcaatgaaggctgcgacctaa

DBGET integrated database retrieval system