KEGG   Shewanella putrefaciens CN-32: Sputcn32_2452Help
Entry
Sputcn32_2452     CDS       T00513                                 

Definition
N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (EC:2.1.1.72)
Orthology
K07320  
putative adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
spc  Shewanella putrefaciens CN-32
Brite
Enzymes [BR:spc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Sputcn32_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2841866..2842810)
Genome map
AA seq 314 aa AA seqDB search
MDKIFVDEAVTELRTIGDMLRWAVSRFNDANVYYGHGTDNAWDEAIALVFHALHLPEEIG
QQVILSNLTSSEKHKIVELIIRRVRERLPVPYLTNKARFAGLEFYVDERVLVPRSPIAEM
IANRFSPWLYNKPVTRILDLCTGSACIAIACAYEFEDAEVDALDISEDALDVAQINIETL
GVMDRVFPMQSDLFSGIPEGPQYDLIVSNPPYVDAEDIGDMPDEYHHEPAIGLASGRDGL
DLTKRILANAAQYLTPTGLLVVEVGNSMVHLIEQFPEVPFTWINFENGGDGVFVLTRDQL
VENQSVFGIYRDAQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttggataagatctttgtagatgaagctgtgacagaattacgtaccattggcgatatgtta
cgttgggccgtgagccgttttaacgatgccaatgtgtattatggtcatggtactgataac
gcgtgggatgaagccatcgccttagttttccatgctttacacttaccagaagaaatcggc
cagcaagtgattttaagtaacttgaccagcagtgaaaaacacaaaattgtcgagttgatt
attcgtcgggtgagagaacgcttgcctgtgccttacttgaccaacaaggcccgttttgca
gggcttgagttttacgtcgatgagcgcgtgttagtaccacgttcgccgattgccgaaatg
atcgctaaccgttttagcccttggttatataacaagccagtcacacgtattttagattta
tgtacaggcagcgcttgtatcgccattgcctgcgcctatgaatttgaagacgccgaagtc
gatgcgctggatatcagcgaagatgccttagatgtggcgcaaatcaatattgaaacctta
ggtgtgatggacagagtgttcccgatgcaatcggatctgttttcgggcatcccagaaggg
cctcagtatgatttgattgtttcaaacccaccttatgtggatgctgaagacattggtgac
atgccggatgaatatcaccatgagccggctattggtttagcctcaggtcgcgacgggtta
gatttaaccaagcgtatactcgccaatgccgcgcaatacctcacgccaacgggtttactc
gtggtcgaagtgggaaattctatggtgcatttgattgagcagtttccagaagtgccattc
acttggattaactttgaaaatggtggcgatggcgtatttgtgttaactcgcgaccaactg
gttgaaaatcaatctgtatttggcatttatcgcgacgcgcaatag

DBGET integrated database retrieval system