KEGG   Shewanella putrefaciens CN-32: Sputcn32_2459Help
Entry
Sputcn32_2459     CDS       T00513                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputcn32_2459 (fadJ)
   01212 Fatty acid metabolism
    Sputcn32_2459 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sputcn32_2459 (fadJ)
   00650 Butanoate metabolism
    Sputcn32_2459 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Sputcn32_2459 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Sputcn32_2459 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sputcn32_2459 (fadJ)
   00310 Lysine degradation
    Sputcn32_2459 (fadJ)
   00380 Tryptophan metabolism
    Sputcn32_2459 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sputcn32_2459 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sputcn32_2459 (fadJ)
   00281 Geraniol degradation
    Sputcn32_2459 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Sputcn32_2459 (fadJ)
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sputcn32_2459 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sputcn32_2459 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sputcn32_2459 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2852897..2855017)
Genome map
AA seq 706 aa AA seqDB search
MEKTFNLTRRDDGIAILTMDVPGETMNTLKAQFGPEISEILAEIKSDPHIRGLVLISGKK
DSFVAGADISMLDACKTAGDAKALSQQGHVVFNELEALKIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKRAPKPIKKSLVNQVLEGTSFGRNIIFDQATKQVEKK
TQGNYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGATPRKVKKAVILGGGLMGGGIASVTTTKAKIPVRVKDISEKGLSNALAYAYKLLDK
GVKRRHMTPAVRDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPISQIAEAATRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILDKELGERFKAPAAFDKLLGDDRKGRKNGKGFYQYGASSKKTKAVDET
VYGVLGIKPSTNKDAKALAERCVVQMLNEAVRCLDEGIIASPRDGDIGAIFGIGFPPFLG
GPFHYIDTLGAANLVKILEGYQSQFGNRFEPCERLKTMARENVSFF
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacctttaatttaacccgccgcgacgacggcatcgccattttgactatggat
gttcctggcgaaaccatgaacaccctaaaagcacagtttggccctgaaatcagtgagatt
ctggctgagattaaaagcgatcctcatattcgtggacttgtgctgatctctggcaaaaaa
gactctttcgtcgcgggcgcggatatttccatgctcgatgcctgtaaaacggcgggcgat
gccaaagccttatcccagcaagggcatgtggtttttaatgagttagaagcgttaaaaatt
cctgtggttgcggcaatccatggtgcctgtttaggtggtggcttagagttagccttagcc
tgtcatcaaagggtatgtagcgacgatggtaaaaccatgctcggcgtaccggaagttcaa
cttggcctattgcctggcggcggtgggacgcaacgtttgcctcgtttagtcggcattacc
actgccttagatatgatgctcaccggtaaacaaatccgtcctaaacaagccttgaaaatg
ggcttagtgaatgatgttgtaccgcagaccattttgctgcaaaccgccgttgagatggcg
cttgctggtaaacgtgcaccgaaacctattaaaaagtcactcgttaatcaagtgcttgaa
ggcacgagctttggccgtaacattattttcgatcaagcgactaaacaagtcgaaaagaaa
acccaaggtaattatccagcaccagccaagattattgactgcgtgcgtcaagggattgcg
aaggggatgcaaaaagggttagaagtcgaagcaagtcactttgccgaattagtggtatca
aaagaatctgaagcgctgcgcagtatttttttcgccaccactgaaatgaagaaagaaacc
ggcgcagagggtgcaacgccgcgtaaagtgaagaaagcggtgatcttaggtggtggttta
atgggcggaggcattgcctctgtgactaccactaaggctaaaatccccgttcgggtaaaa
gacatcagcgaaaagggcttaagcaatgcattagcctacgcttataagttgttggataaa
ggggtaaagcgccgccatatgacgcctgctgtccgtgacaacttaatggcgttgatgacg
acaaccactgagtataaaggcgttaaagatgccgacatcgttgtggaagcggtatttgaa
gacttagcgcttaagcatcaaatggtgaaagacattgagcgtgagtgtggtgagcacacg
atttttgcttcaaatacctcatctttgcctattagccaaattgccgaagcggcaacgcgt
cctgaaaacgtgattggtctacattatttctcgccagtggaaaaaatgccgctggtggaa
gtgattgcccacgctaaaacctcgccagaaaccattgcgacaaccgtcgcatttgcccgt
aagcaaggtaaaacaccgatagtggtacaggatggtgcgggtttctacgtgaaccgtatt
ctggcgctctatatgaacgaggcggcgcaattactactcgaaggccaaagtgttgagcat
ttggataaagctttagtgaaatttggcttcccagtgggacctattactttgctcgacgaa
gtgggtatcgacgtgggcgcaaaaatttcaccgatccttgataaagaactgggtgaacgc
tttaaagcgccagccgcatttgacaagcttttgggtgacgatcgtaaaggccgcaaaaat
ggcaaaggtttctatcaatacggcgcatcgagcaagaaaactaaagctgtcgatgaaact
gtgtatggcgtattaggcattaagcctagcaccaataaagatgcaaaagcacttgctgag
cgttgtgttgtacaaatgctcaatgaagcggtgcgttgcttggatgagggtattatcgca
tcgccaagagatggtgatattggcgctatttttggtattggcttcccgccattcctcggt
ggtccattccattatattgacactttaggcgccgcgaacttagtgaagatccttgaaggt
tatcaaagtcaattcggtaacagattcgaaccttgtgagcgtttaaaaacgatggctaga
gagaatgttagctttttctaa

DBGET integrated database retrieval system