KEGG   Shewanella putrefaciens CN-32: Sputcn32_2821Help
Entry
Sputcn32_2821     CDS       T00513                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sputcn32_2821 (deoA)
Enzymes [BR:spc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sputcn32_2821 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3277067..3278398)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSPAEIQFFVQGITTNAVSEGQIAAFGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNETEARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADAKGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKIDSSTPIAVIHAQSEAAFTEAENAVKKA
IHIGETAPEKTPEIYAYIRAADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagtcctgca
gaaatacagttttttgtccaaggtatcactactaacgcagtatccgaaggccagatcgct
gcattcggtatggcagtgtactttaatgacatgaatatggatgaaagaatcgctttgacg
acggcaatgcgtgattctggcactgtacttaattggcaatcattgggactcaatggccct
gttatcgacaaacacagcactggcggtgtgggcgatgtgattagccttatgcttggccct
atggctgcggcttgtggtggttatgtgccgatgatttcaggacgtggcctaggccatacg
ggcggcacgctcgataagtttgatgcgattccaggttatcaaactgagccatcaagcgaa
ctatttcgcaaagtcgttaaagaggtcggtgtcgccattattggtcagacaggtgatctc
gttcctgccgataaacgcttctattctatccgtgataataccgctaccgttgaatctatt
tccctcatcacagcgtcgattctgtctaagaaattagcctgcaatttagatgcactcgct
atggatgtaaaagtcggtagtggcgcttttatgcctacctatgaggcttctgaagagtta
gcgcgcagtattactgctgtagccaatggtgcgggaactaagaccacagcattacttacc
gacatgaaccaagtgctagcctcctgtgccggtaacgcggttgaagtgaaagaagccatt
gacttcttaacaggtgcttaccgtaacccacgtctatatgaagtgactatgggcctttgt
gctgagatgttgctccttggcggtcttgcaagcaatgaaactgaggctcgcgctaaactc
aatcgtgtgctcgataacggccgtgccgctgaaatttttggcaagatggtctcagggctt
ggtgggccagtcgattttgttgaaaactacagtaagtacctaccgcaatcacagattatt
cgccctgtatttgccgatgcaaagggttatgcctatagcatggatacccgagagcttggt
ttagccgtggtgactctcggtggtggccgcagaaagcctggcgatgcactagactatagt
gttggtttaacccaagtctgtgcccttggtgataaaattgattcatcaacgcctattgct
gttatccacgcacagtctgaagcagcctttacagaagcggaaaatgcggtgaaaaaagcg
attcacataggtgaaaccgctccagaaaaaacacctgagatctacgcttacattcgtgca
gcggatctttaa

DBGET integrated database retrieval system