KEGG   Shewanella putrefaciens CN-32: Sputcn32_2844Help
Entry
Sputcn32_2844     CDS       T00513                                 

Gene name
secF
Definition
preprotein translocase subunit SecF
Orthology
K03074  
preprotein translocase subunit SecF
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:spc03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:spc03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3304463..3305359)
Genome map
AA seq 298 aa AA seqDB search
MKNINLTGQLTLWRYISSAISIFLMLASLTIIGVKGFNWGLDFTGGVVTEVQIDRKITSS
ELQPLLNAAYQQEVSVVSASEPGRWVLRYADTAQSNVDIAQTLAPLGEIQVLNTSIVGPQ
VGKELAEQGGLALLVAMLCILGYLSYRFEWRLASGALFALVHDVIFVLAFFALTQMEFNL
TVLAAVLAILGYSLNDSIIIADRIRELLIAKPKLAIQEINNQAIVATFSRTMVTSGTTLM
TVGALWIMGGGPLEGFSIAMFIGILTGTFSSISVGTSLPELLGLSPEHYKVQVISDTP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatcaatctaacgggtcaattaactctgtggcgctatatttcgagcgcgatt
tcgatctttttaatgctggcatcgttaaccattatcggcgtgaagggctttaactggggc
ttagattttaccggtggtgtggtcaccgaagtgcagatcgatagaaaaattaccagcagt
gagttgcaacctttactcaacgctgcttatcaacaagaggtcagtgtggtttcggccagt
gagccggggcgttgggtgttacgttatgctgacactgcacaaagcaatgtggatattgcg
caaaccttagcgccactgggcgagatacaagtgctaaataccagtattgttggcccgcag
gtaggtaaagaattggcagagcagggtggtttagcactgctagtcgctatgctgtgtatt
ttggggtacttaagttatcgcttcgaatggcggcttgcttctggtgcactattcgcgtta
gtgcatgatgtgatttttgtgcttgctttctttgcgctgacgcagatggagtttaattta
actgtgctcgctgctgtgctggcgattttaggctattccttaaatgactcgattatcatt
gctgatcgtattcgtgagttattaattgctaagccaaaacttgcgattcaagagattaat
aatcaagcgattgtggcgacgttttcccgcactatggtgacatcagggaccaccttaatg
acggttggtgcactgtggatcatgggtggtgggccgctggaggggttttcgattgccatg
tttatcggtattttaacgggaacattctcatctatttctgttggtacttcattacctgaa
ctgttaggtttatcgccagagcattataaggtgcaagtcatttcagatacgccttaa

DBGET integrated database retrieval system