KEGG   Shewanella putrefaciens CN-32: Sputcn32_2931Help
Entry
Sputcn32_2931     CDS       T00513                                 

Definition
ribose-5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputcn32_2931
   01230 Biosynthesis of amino acids
    Sputcn32_2931
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputcn32_2931
Enzymes [BR:spc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Sputcn32_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3398452..3399114
Genome map
AA seq 220 aa AA seqDB search
MTQDEMKKAAGWAALKYVEEGSIVGVGTGSTVNHFIDALATMKDDIEGAVSSSEASTQKM
KALGIPVYDLNSVDRLSVYVDGADEINDRMDMIKGGGAALTREKIVAAVAEKFICIVDNT
KQVNILGEFPLPVEVIPMARSYVARQLVKLGGDPVYREGVVTDNGNVILDVYNLKILNPK
ELESQINEIVGVVTNGLFAKRGADVLLVGTPDGVKTFTAK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatgaaatgaaaaaagctgctggttgggccgcgcttaagtacgttgaagaa
ggcagtattgtcggtgttggtacaggttcgactgtaaaccactttattgatgcactcgct
accatgaaagatgatatcgaaggtgcggtttcaagctcggaagcatccactcagaaaatg
aaagcgctaggaattcccgtttatgacttaaacagcgtcgatcgtttatctgtctatgta
gacggtgccgatgaaatcaacgatcgtatggatatgatcaaaggtggtggcgcagcatta
actcgcgagaaaattgtcgcggctgtagctgagaagtttatctgcatcgttgataacact
aaacaagtcaacatattaggtgaatttccgctacccgtagaagtcattccaatggcacgc
tcttatgtagcgcgtcaacttgttaaacttggcggcgatcctgtgtaccgtgaaggcgtt
gttaccgataacggcaacgtgatcctcgatgtgtacaatcttaagatccttaatccaaaa
gaattagaaagtcagatcaatgagatagtcggtgtagtgactaacggtctgtttgccaaa
cgcggtgcggatgtgttactcgttggcacccctgatggcgtaaaaacgtttactgccaaa
taa

DBGET integrated database retrieval system