KEGG   Shewanella putrefaciens CN-32: Sputcn32_3163Help
Entry
Sputcn32_3163     CDS       T00513                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:spc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:spc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3681878..3683200
Genome map
AA seq 440 aa AA seqDB search
MSFTKAPLLLLGIGLLLSTSTWANIETGPTKAPSRPKNIVIMIGDGMGPAYTSAYRYYKD
NPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQP
LPTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDAIALSYLETNADVFLGGG
QKYFSPELLAQFTAKGYQHITRFDDLATITQPKVLGLFAEVQLPWAIDEKEAKKLSTLTQ
KALSLLSQNEQGFVLLVEGSLIDWAGHNNDIATVMGEMDEFSNAIEVVEQFVRQNPDTLM
VITADHNTGGLSIGANGNYNWNPEILRNISASSDTLALAAISGDEWQADLARGLGFELSE
EEVTKLNVARMQGLETMAIAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQD
NTDIANKILSLLPKPKKSKS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttgctcggcataggcttattgctatcgacttcg
acttgggcaaacatcgaaacaggcccaacaaaagcaccatctcgcccgaaaaatatcgtc
attatgataggtgatggtatggggcctgcttatacgagcgcctatcgttactacaaagat
aatccagataccgaagaagtcgaacaaaccgtattcgaccgtttactggtgggtatggcg
agtacctatcccgccagtgtcagtggctatgttaccgactctgcggccgccgcaaccgcg
ctcgccacaggcgttaaatcgtataatggggcgatttcagttgatactcaaaagcaacca
ctaccgaccatactcgaaaaagccaaatcccttggcttaagcacaggcgtagctgttaca
tcacaaatcaaccatgccacgccagcggcatttttggcccataatgaaagccgtaaaaac
tacgatgcgatagcactcagttatttagaaactaatgccgatgtatttttaggtggcggt
caaaagtatttttcacccgagctgctagcgcaatttacagctaaaggctatcaacacatc
acccgttttgatgatctcgccactatcacccaacctaaagtgttaggtctgtttgccgag
gtgcaattgccttgggccattgatgaaaaagaagctaaaaaactcagcaccttaacccag
aaagcccttagtttactctcacaaaatgaacaagggtttgtactcttagttgaagggagt
ttaatcgactgggcgggccataataatgacatagcgactgtgatgggggaaatggatgag
ttctctaatgccattgaagtggttgaacaatttgttcgccaaaatccagacacgctaatg
gtcattaccgccgaccacaatactggaggtctatcgattggtgccaatggtaactacaac
tggaatcccgaaattctgcgaaatatttccgccagttcagacaccttagccttagccgcc
attagcggagatgaatggcaagctgatctcgcccgtggtttaggatttgagcttagcgaa
gaagaagtgaccaaattaaatgttgccagaatgcaggggttagaaaccatggccatcgcg
atccgccatgttatcgataaacgtacagatacaggatggacaactgacggccacacaggt
acagatgtacaagtctttgctgcaggtcctgcatcagagctgtttaacggccatcaggac
aatacagatattgccaataagatcttaagtttattgccaaaaccgaagaaatccaaaagt
taa

DBGET integrated database retrieval system