KEGG   Shewanella putrefaciens CN-32: Sputcn32_3163Help
Entry
Sputcn32_3163     CDS       T00513                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputcn32_3163
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sputcn32_3163
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sputcn32_3163
Enzymes [BR:spc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sputcn32_3163
Exosome [BR:spc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sputcn32_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3681878..3683200
Genome map
AA seq 440 aa AA seqDB search
MSFTKAPLLLLGIGLLLSTSTWANIETGPTKAPSRPKNIVIMIGDGMGPAYTSAYRYYKD
NPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQP
LPTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDAIALSYLETNADVFLGGG
QKYFSPELLAQFTAKGYQHITRFDDLATITQPKVLGLFAEVQLPWAIDEKEAKKLSTLTQ
KALSLLSQNEQGFVLLVEGSLIDWAGHNNDIATVMGEMDEFSNAIEVVEQFVRQNPDTLM
VITADHNTGGLSIGANGNYNWNPEILRNISASSDTLALAAISGDEWQADLARGLGFELSE
EEVTKLNVARMQGLETMAIAIRHVIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQD
NTDIANKILSLLPKPKKSKS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttgctcggcataggcttattgctatcgacttcg
acttgggcaaacatcgaaacaggcccaacaaaagcaccatctcgcccgaaaaatatcgtc
attatgataggtgatggtatggggcctgcttatacgagcgcctatcgttactacaaagat
aatccagataccgaagaagtcgaacaaaccgtattcgaccgtttactggtgggtatggcg
agtacctatcccgccagtgtcagtggctatgttaccgactctgcggccgccgcaaccgcg
ctcgccacaggcgttaaatcgtataatggggcgatttcagttgatactcaaaagcaacca
ctaccgaccatactcgaaaaagccaaatcccttggcttaagcacaggcgtagctgttaca
tcacaaatcaaccatgccacgccagcggcatttttggcccataatgaaagccgtaaaaac
tacgatgcgatagcactcagttatttagaaactaatgccgatgtatttttaggtggcggt
caaaagtatttttcacccgagctgctagcgcaatttacagctaaaggctatcaacacatc
acccgttttgatgatctcgccactatcacccaacctaaagtgttaggtctgtttgccgag
gtgcaattgccttgggccattgatgaaaaagaagctaaaaaactcagcaccttaacccag
aaagcccttagtttactctcacaaaatgaacaagggtttgtactcttagttgaagggagt
ttaatcgactgggcgggccataataatgacatagcgactgtgatgggggaaatggatgag
ttctctaatgccattgaagtggttgaacaatttgttcgccaaaatccagacacgctaatg
gtcattaccgccgaccacaatactggaggtctatcgattggtgccaatggtaactacaac
tggaatcccgaaattctgcgaaatatttccgccagttcagacaccttagccttagccgcc
attagcggagatgaatggcaagctgatctcgcccgtggtttaggatttgagcttagcgaa
gaagaagtgaccaaattaaatgttgccagaatgcaggggttagaaaccatggccatcgcg
atccgccatgttatcgataaacgtacagatacaggatggacaactgacggccacacaggt
acagatgtacaagtctttgctgcaggtcctgcatcagagctgtttaacggccatcaggac
aatacagatattgccaataagatcttaagtttattgccaaaaccgaagaaatccaaaagt
taa

DBGET integrated database retrieval system