KEGG   Shewanella putrefaciens CN-32: Sputcn32_3179Help
Entry
Sputcn32_3179     CDS       T00513                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sputcn32_3179
Enzymes [BR:spc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sputcn32_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3705670..3706581
Genome map
AA seq 303 aa AA seqDB search
MSQILIIGSANADHVMKFEYLPAAGQTLMSREYRLEHGGKGANQAVACARLAKPDTHIDF
ICHLGKDSVGDDMLQSWLKDGISAEGITQTSNMSTGTAMIFIGDNGENTIGVAAGANAEL
LPEDLENYYALFANAQYLLIQLETPLTTVAKALQMAKRLGVTTVLNPAPAKVLGPNYLQW
VDIITPNETEAAALTGVEINHLDDAHLATQLLHQQGVGIVVITLGAKGAYISSPHFTGLI
PAINVQAVDTVAAGDTFNGALVVGLSEGMSIDAAVGFANAASAMTVTRQGAQRAIPYRHE
VPN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatactcattatcggcagtgccaatgccgaccatgtgatgaaatttgaatac
ctacccgccgcaggacaaaccttgatgagccgagaataccgtcttgaacacggtggtaag
ggagcaaatcaagcggttgcctgcgcacgtttagccaagccagatacgcacattgatttt
atctgccacttaggcaaagacagcgtcggcgatgatatgctccaaagctggctaaaagac
ggcattagtgcagaagggatcactcaaacatccaatatgagtactggaacggccatgatt
tttatcggtgacaacggtgaaaataccattggcgttgccgcaggtgctaatgcggagctg
ttacctgaagatttagaaaattattatgccctatttgcgaatgcacagtacctgcttatc
cagttagaaaccccattgacgacggtagcgaaagcgctacaaatggcgaaaagactgggc
gttacgacagtattaaatcctgctccagccaaagtattaggacctaattatcttcaatgg
gtggatattattaccccaaatgaaaccgaagccgcggcactgactggcgtcgagattaat
cacctcgatgatgcgcatcttgcaacacaattgctgcatcaacagggcgtaggtattgtg
gttatcactttaggggcaaagggtgcttatatcagcagtcctcattttaccgggctcata
cccgccatcaatgtacaagccgttgataccgttgcggcgggtgatacctttaatggtgct
ttagttgtcgggttaagtgagggaatgtcgattgatgctgccgtgggatttgccaatgcc
gccagcgccatgacggtgactcgccaaggcgcacaacgggccatcccctaccgccacgaa
gtccctaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system