KEGG   Shewanella putrefaciens CN-32: Sputcn32_3184Help
Entry
Sputcn32_3184     CDS       T00513                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputcn32_3184
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sputcn32_3184
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sputcn32_3184
Enzymes [BR:spc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sputcn32_3184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3710399..3712162)
Genome map
AA seq 587 aa AA seqDB search
MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDNDDNAVPAQFLHGVASGDPAHDAVILWT
RVTPESQGDVKVSWQVASDAAFSQLVTTGETVTNASRDYTVKVDARGLRAGQHYFYRFKT
GDKTSALGQTQTLPEGEVSSVKLAVLSCSNFPAGYFNVYELAAAQDDLAAVVHLGDYIYE
YPRGGYASEHAAELGREVLPANELLSLSDYRTRYGQYRTDASLQKLHAKVPFITVWDDHE
VANDTWRDGAENHNEDEGDFTARKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVDL
HMLDTRVLARDKQLDYADYMDATTGTFDGERFLTDVTSTSRTLLGLTQLLWLQGTLLQAT
GKWQVLGQQVLMGKMSLPAAIATQQMSIPQFAMLGALAKLAARAAANDPTLTAQELQYLQ
ANQALLTPEVLALLQLPSIPYNLDAWDGYAYEREVILGTAKSKNLNLVVIAGDTHNAWAS
ELKDMKGDTVGVEFATSSVSSPGLEYYLNLPAEQILATEAAIVELVPDLKYTNLKDRGFM
TLTFNPDEVRSDWHYVDTILSKDFQLATARSYSAVTKAGEHTINPVS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtaccgtgactcgtcgtgattttctggctatgtcggccaaaggtgttggcgtt
gctgttatttcctacggcttgatgggctgtagtgataatgatgataatgctgtccccgcg
caatttcttcatggggtagccagcggcgatccagcccatgatgccgttatcctatggact
cgtgtaacacccgagtcacaaggtgatgtgaaagtgagttggcaagtggcgagtgatgcg
gcgttttcacagttagtcactacgggggaaacggtgactaatgccagccgtgattacacg
gttaaagtggatgcccgcggtttacgtgcagggcaacactatttttaccgctttaagacg
ggggataaaacttcagcgttaggtcaaacccaaactttgccagaaggtgaagtcagctca
gtaaagttagccgtactttcttgttctaatttccctgcgggttactttaacgtatatgag
ttagcggcggcgcaggacgatttagctgctgtggtgcacttaggggattacatttacgaa
tatcctcgcggtggttatgccagtgaacatgcggcagaattgggccgagaagtgcttccc
gccaatgagttattgagcttaagcgattatcgtacccgttatggccagtaccgcaccgat
gcgagtttgcaaaaattacatgccaaagtgccttttatcacggtatgggatgaccacgaa
gtggctaacgatacctggcgtgatggtgctgaaaatcacaacgaagatgaaggggatttt
actgctcgtaaagaagcggcattacaggcttattttgagtggttgcccattcgcccatgg
cgtgaaggcaaccatgaggagatttaccgcagctttagttacggtaacttagtggatcta
catatgctagatactcgcgtgttagcgcgggataaacagctcgattatgctgattatatg
gatgccactacaggcacctttgatggcgagcgttttcttacggatgtgacatcaacctcg
cgcacgttattaggtttgacacagttattatggttgcaaggtacattattgcaggcaacg
ggtaagtggcaggtgttaggtcagcaagtgttaatggggaaaatgtcattgccagctgcg
attgccactcagcagatgagcattccccaatttgctatgttaggggctttagctaagtta
gcggcgcgtgcagcggccaatgatcccaccttaacggcccaagaattacaatatctccaa
gccaaccaagccttattaaccccagaagtgttagccctgctgcaattgccatcgattccc
tataacttagatgcttgggatggttatgcctatgagcgtgaagtgattttaggtacggct
aaatcgaaaaatctcaacctagtggtgattgcgggtgatacccataacgcttgggcgagt
gagcttaaagatatgaagggcgatactgttggtgtggagtttgcgacgagttcggtatcc
tcgccggggcttgagtattatttgaatctccctgcagaacagatcctggcaaccgaagcg
gcgattgtcgagttagtgccagatcttaagtacaccaacttaaaagaccgcggctttatg
acgctgacattcaatcccgatgaggtgcgcagcgattggcattatgtggacacgattttg
tcgaaggatttccaacttgcaacggcgcgtagttacagtgcggtgacgaaagcaggtgag
cacacgattaatcctgtgagttaa

DBGET integrated database retrieval system