KEGG   Shewanella putrefaciens CN-32: Sputcn32_3217Help
Entry
Sputcn32_3217     CDS       T00513                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sputcn32_3217
   00670 One carbon pool by folate
    Sputcn32_3217
Enzymes [BR:spc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sputcn32_3217
    1.5.1.-  
     Sputcn32_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3744882..3745601)
Genome map
AA seq 239 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHLLAQGHSVIGTYRSHYPSIDKLRVLGATLIQCDFYDNVQ
VQGLIDQLGQYPKIRAIIHNASDWLADSSQTFTASEVIQRMMQVHVSVPYQLNLALASQL
QAGAEEEIGASDIIHITDYVAEKGSAKHIAYAASKAALHNLTLSFAAKFAPEVKVNSIAP
AMILFNQGDDEAYQQKTLAKALLPKEAGNEEIIDLVEYLLNSRYVTGRSHHVDGGRHLR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcatcatcacaggcgtgggtaagcgtatcggatacgccttagccaaa
catcttcttgcccaaggtcatagtgtgattggcacctatcgtagccattatccgagtatt
gataagctgcgggttttgggcgcgactttaattcaatgtgacttttacgacaatgttcag
gtacaaggcttaattgatcaattgggccagtatccaaagatccgcgccattatccataac
gcctcggattggttggcggatagcagtcaaacctttactgccagtgaagtgatacagcgg
atgatgcaggtgcacgtaagcgtaccttatcaattgaatttggcgttagcatcgcagttg
caagcgggagcagaagaggagattggtgccagcgatatcatccatatcaccgactatgtg
gccgaaaagggcagtgctaaacatatcgcttatgccgccagtaaagcggcgctacataat
ttaactttgtcctttgcggctaaattcgcccccgaagtgaaagtcaattcgattgcacca
gcgatgatcctatttaatcaaggcgatgatgaagcctatcagcaaaaaaccttagctaaa
gcactactgccaaaagaggcggggaatgaagagattatcgacttagtggaatatctgcta
aatagccgctatgtcacggggcgcagccatcatgtcgatggtggtcggcatttaaggtaa

DBGET integrated database retrieval system