KEGG   Shewanella putrefaciens CN-32: Sputcn32_3416Help
Entry
Sputcn32_3416     CDS       T00513                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sputcn32_3416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sputcn32_3416
   00020 Citrate cycle (TCA cycle)
    Sputcn32_3416
   00620 Pyruvate metabolism
    Sputcn32_3416
Enzymes [BR:spc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sputcn32_3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3982700..3984709)
Genome map
AA seq 669 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICAAVGDTLAADESIITVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAADPAPVAAPSSAPAAAPVQAAPAPAVPAATSTQAVET
KVVEVAVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKEVKV
AVGDKVSEGSLVIMLEVGGAAPAVAASAPTVAAQAAPAATVAPVAPASATPTASVVTVKE
IQVPDIGDASNVDVIEVLVSVGDMITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGD
KVSQGSVIATVETTAVGAAAPAPVAQAPAVQEVAPVAAQAPASRPPVPHHPSAGAPVSTG
AVHASPAVRRLAREFGVDLTQVTGSGRKGRIMKEDVQAYVKYELSRPKATAATSVGAGNG
GGLQVIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFR
KQQNDAAAKKKADYKITPLVFMMKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVD
TPNGLVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAF
TPIVNYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGI
LSDIRTLIL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgacgaagtgcaagtgatc
gaaatttgtgccgctgtgggtgataccctcgcggccgatgaatcgattattaccgttgaa
agcgacaaggcgactatggatattcctgcgcctttcgctggtgtgttagccgagttaaaa
gtggctgtgggtgataaagtctctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgccgatcctgctccagttgcggcaccatcatccgcgccagcagctgcaccg
gttcaagcggctcctgctcccgcagtaccagcagcgacatcgactcaagctgttgagaca
aaagtcgttgaagtggctgtgccagatatcggtggcgacactgatgtctcggttatcgaa
gtgctggttgccgtcggtgataagattgaggttgatagcggtttaattactctcgaaact
gacaaagcgaccatggatgtaccttcaccttttgctggtgtggtaaaagaagtcaaagta
gccgttggcgataaagtgtcggaaggctctttagtcatcatgcttgaagtgggtggcgca
gctcctgctgtggcagcaagtgcgccaaccgttgccgctcaggcggctcctgccgctacg
gtagcgccagtggctccggcttctgcaactccaactgcaagtgtggttacggtaaaagaa
attcaagtgccagatattggcgatgcaagcaatgtcgatgtgattgaagtgctagtgtct
gtgggcgatatgatcacggccgaccaaggtttaataacccttgaaactgacaaagccacc
atggaagtgccagcgccatttgccggcaaactattgtcgttaaccgttaaagtgggtgat
aaggtttctcaaggtagcgtgatagctaccgttgaaacgactgctgttggagccgctgcg
cctgcgccagttgctcaagcgccagcagtgcaagaagtggcgccagttgctgctcaagca
cctgcaagccgtccgccagtgccgcatcatccaagtgcaggtgcgcctgtgtcgactggt
gcggtacatgcatcgcctgcggtacgccgtttagcccgtgaatttggtgtggatctcacc
caagtcactggttctggccgtaaaggtcgcattatgaaagaagacgttcaggcgtatgtg
aaatacgaactgtcgcgtccgaaagcaactgcggcaacgtcagtcggcgctggcaatggc
ggtggtctgcaagtgattgcagcacctaaagtggatttcagtaagtttggtgaagtggaa
gaaattccattaagccgtatccagaagatctctggccctaacttacaccgcaactgggtg
actattccgcatgtgactcagttcgatgaagctgatatcactgaaatggaagagttccgt
aagcagcaaaacgacgcagcggcgaagaagaaagccgattataagatcacgcctttagtc
tttatgatgaaagcggtggctaagacgttgcaacagttcccagtgttcaactcgagctta
agctctgatggcgaatcactgatccagaagaagtatttccacatcggtgtggcggtggat
acgccaaacggtttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgag
ttatctcgtgaactggctgatatctctatccgtgcccgtgatggcaagctgaaatctgct
gatatgcagggcagctgtttcaccatttcaagtttaggtggtattggcggtacggcgttt
acgcctatcgttaactacccagatgtggcgattttaggtgtgtctaaatctgaaattaag
cctaagtggaatggtaaagagttcgagcctaaattgatgttgccactgtcgctatcatac
gatcaccgcgtgatcgatggtgccatggctgcacgctttagcgtgaccctgtcaggaatt
ctgtccgatattcgtactttgattctgtaa

DBGET integrated database retrieval system