KEGG   Shewanella putrefaciens CN-32: Sputcn32_3542Help
Entry
Sputcn32_3542     CDS       T00513                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:spc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:spc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4116080..4117186
Genome map
AA seq 368 aa AA seqDB search
MKKPPIIWLNVSLFAVTFLCAVILVPWRGIVHGYGASEWIAFIVLAFASGLSITAGYHRL
WSHKAYKAHPAVRFIYALGGALALQNSALHWASDHRVHHKHVDDNDKDPYSAKMGFWYSH
IGWMLREYQAQRYHDYQNVRDLQNDRIVMWQHKHYLALVLLMNIGLPAFLGWLNGDVISM
LLMAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGFLAMLTYGEGYHNFHHIFE
NDYRNGIKWWHYDPTKWLIRSLSWFGLAKDLRTSPQERIESARLQMQLLQTKNKVTHLPN
ADEIIEKIQAEYELLKLHLMDYYQAQKTLLEAKRKQLVDQQLLQQVEELKARFLVQQKHW
RSLTATYS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccccctattatctggcttaatgttagtttgtttgctgtgacctttctctgc
gcggtcattcttgttccatggcgaggcatagttcacggctatggtgccagtgaatggata
gcttttattgtcctcgcctttgcaagcgggctgtcaattacggcggggtatcacagacta
tggtcccataaagcctataaagcacatcctgcggtgcgctttatttatgcacttggcggc
gccttagctttacaaaacagtgcattacattgggcatcggatcaccgagttcaccataag
catgttgatgataacgataaagacccctattccgcgaaaatgggattctggtacagccat
atcggttggatgctgcgtgaataccaagcgcagcgttatcacgattatcaaaatgtgcgc
gatttgcagaatgaccgtatcgttatgtggcaacacaaacactatttggcacttgtactg
ttaatgaacattggtctacctgcatttttaggttggctcaatggagatgttatctcaatg
ctattaatggctggtttgctgcgtttagtggtggtgcatcactgcactttctttatcaac
tctttggcccatgtatggggcagccagccctatacggataaaaataccgcacgagataat
ggctttctggctatgttgacctacggcgagggttaccataatttccatcatatctttgaa
aatgactatcgtaatggcattaaatggtggcactacgatccaactaaatggttgattaga
tcattgtcttggtttggattagcgaaagatttacgcactagcccacaagaacgtatcgag
agtgcgcgtttgcagatgcaactgctacagaccaaaaataaagtaacccatctgccaaat
gccgatgaaattattgaaaaaatccaagcggagtatgagttattaaagctgcacttaatg
gattactatcaagcacaaaaaaccttgcttgaggcaaaacgtaagcaacttgtcgatcaa
caactattgcaacaagttgaagaactaaaggcacgtttcttagtccaacaaaaacattgg
cgcagcctgaccgcaacttatagctaa

DBGET integrated database retrieval system