KEGG   Shewanella putrefaciens CN-32: Sputcn32_3588Help
Entry
Sputcn32_3588     CDS       T00513                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sputcn32_3588
Enzymes [BR:spc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sputcn32_3588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4166127..4166867
Genome map
AA seq 246 aa AA seqDB search
MKVLLTRPEGRNQSMVDALNARGITHYVTPLLGVEPTNDITTDASHPLAGTDIIICISAN
AVIFANKALNKINAQIATWPKVQYFAVGHATWEALDQLGICAVEAPDDCQQTEGLLTLAS
LQHIPAKKVTIIRGVGGREALAEQLTRRGANVRYWEVYQRVCPPLDGYAITQQWQHFGID
TIVVTSGEVLNNLIKLVPKELFAWLRSCHIIVPSNRVEAQAHAFGINHVTNACAANSKAV
LNALKL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactgacgcgccctgaggggcgcaatcagtctatggtcgatgccttgaat
gcacgaggcattacccactatgtcacgccattattgggtgttgaaccaactaacgacatc
acaacggatgcttcgcatccattggcagggacagatattattatctgtatcagtgctaac
gctgttatttttgcgaataaagccttaaacaaaattaatgcacaaatagcaacatggcct
aaagttcaatattttgctgtgggccatgcaacatgggaggcattagatcagttaggcatt
tgcgcagttgaagcccccgatgattgccaacaaacggaaggcttacttacccttgcttct
ctacaacatattccagctaaaaaagtaacgattatacgtggtgttggtggccgcgaagct
ctcgctgagcaattaacccgccgtggcgcgaatgtacgctattgggaagtatatcagcga
gtgtgtccaccgttagacggatatgctattacacaacaatggcaacactttggtattgat
accattgtggtcaccagtggcgaagttctcaataacctgattaaactagtgccaaaagag
ttatttgcatggctgcgctcatgtcatatcatagtcccaagtaaccgagtagaagctcaa
gctcacgcctttggtataaaccacgtcaccaatgcctgtgccgccaacagcaaagccgtg
ctaaacgcccttaaactttaa

DBGET integrated database retrieval system