KEGG   Shewanella putrefaciens CN-32: Sputcn32_3630Help
Entry
Sputcn32_3630     CDS       T00513                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
spc00230  Purine metabolism
spc01100  Metabolic pathways
Module
spc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sputcn32_3630
Enzymes [BR:spc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sputcn32_3630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 AAA_22 ABC_tran AAA_29 cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: ABP77338
UniProt: A4YBK5
Position
4230362..4231036
Genome map
AA seq 224 aa AA seqDB search
MHGFLGPSCVYQLDILLMTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRA
PRPGEVDGQHYHFVNVEQFKTLIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDI
DWQGAEQVKAVMPEAVGVFILPPSKAELERRLTGRGQDSQEVIASRMAQAVSEMSHYKEY
DFIIINDDFDTALADLRAIIRSQRLTGASQIHAQNDMLHDLLAG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcacggctttctgggcccttcttgcgtttaccaactggatattttgctcatgaccgca
cgcggaaatttatttattgtgtcagcgccaagtggtgcgggtaaatcctcgctaatttcg
gcattgttaaaagacaaacctgccgatatgcaggtttcagtatcacatactactcgcgcg
ccgcgcccaggtgaagttgatggccaacactaccacttcgttaatgttgaacaatttaaa
acattaatagctgaaaatgcctttttcgaatgggctgaagtattcggtaattactatggt
acatcacgccatgtgatcgaacatacgctcacccaaggtatcgatgtgttcctcgatatc
gactggcaaggtgccgagcaggttaaagcggttatgcctgaagccgtaggggtatttatt
ttaccgccctcgaaagctgaactagagcgacgcctgactggtcgaggacaagacagtcag
gaagtgattgccagccgaatggcacaagccgtatcagaaatgtcccactataaagaatat
gattttattatcatcaatgatgattttgatacagcactggccgatctgcgtgccatcatt
cgcagccaacgcttaacaggtgctagtcagatccacgcacaaaatgatatgcttcacgat
ctgttggcaggatag

DBGET integrated database retrieval system