KEGG   Shewanella putrefaciens CN-32: Sputcn32_3886Help
Entry
Sputcn32_3886     CDS       T00513                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:spc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4510500..4511315
Genome map
AA seq 271 aa AA seqDB search
MPELPEVEVTRQGIAPFLIEQTVSDLVIRNGSLRWPVPDIAKHIIGQTIRQVRRRAKYLL
IDTDAGTTIVHLGMSGSLRILPHNTPVEKHDHIDLVLANGRILRFNDPRRFGAWLWCELP
EEAHPLLAKLGPEPLTNAFNVNQLATALAGKKKAIKLCLMDNHIVVGVGNIYANEALFAA
GIHPEAEAGKIDNERLSLLVAEVKQILAHAIKQGGTTLKDFTNAEGKPGYFAQKLHVYGR
GGETCTNCGNLLSEIRLGQRTTVFCSICQTR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaagtcacccgtcagggtattgccccctttcttattgag
caaactgtctcggatcttgtgatacgtaatggctcactacgttggccagtacctgatatc
gctaaacacattattggccaaaccatacgccaagtgcgccgacgtgctaaatatctgtta
atcgatacagatgcaggcacgactatcgtccatttaggtatgtcgggaagtttgcggatc
ttgccgcacaacactcccgttgaaaaacatgaccatatcgacttagtgctcgccaatggg
cgtatattacgctttaacgaccctagacgttttggtgcttggctttggtgcgaactccct
gaagaagcccatccattactcgccaaacttgggccagaacctttaaccaatgcctttaat
gttaatcaattagccaccgcattagcgggaaaaaagaaggcaattaaactctgtttaatg
gataaccatattgtcgtcggtgtggggaatatttacgctaacgaggcgctatttgcagca
ggtattcacccagaagccgaagcgggaaaaatcgataatgaacgcttaagcctattagtt
gctgaggtgaagcaaatcttagctcacgcgataaagcagggaggaaccacactgaaagac
ttcaccaatgctgagggtaaaccgggatattttgctcaaaaactccatgtttatggtcga
ggcggcgaaacctgcacaaactgtggaaacctactcagtgaaatccgtttaggccaacgt
accaccgttttttgtagtatttgccaaactcgttga

DBGET integrated database retrieval system