KEGG   Shewanella putrefaciens CN-32: Sputcn32_3916Help
Entry
Sputcn32_3916     CDS       T00513                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
spc  Shewanella putrefaciens CN-32
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sputcn32_3916
Enzymes [BR:spc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sputcn32_3916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4543772..4544755
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQALWQTVVQDTLATADGVMLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELIFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKI
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAATFSAPMYGIKLPMPKGFVRWLASKL
DTTLNGGEPNYVLAGQNYKPVPFKGNELTHSQTRYQAYRELYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
ACRNQALNYALDFFKRYATKNSNGKVV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcaactgaacacgatttaaatacctcagagcagcaa
gccctatggcaaaccgttgtccaagatacgctggccactgccgacggcgtcatgctggcc
tatatgatggtaaaacatccccaagcacataccgcaattgttctcagcagtggtcgagtc
gagtcctatttaaagtatcaagaattgatcttcgacttataccaacagggttactctgtt
tatgccatagatcatcgtggccaagggctatcggatcgaatgacaatcaacccacatatg
ggacacgtgcgaagatttaatgattatatcgatgactttgctctatttatgcagaagata
gtgttaccacaaaacgacaaacaactcatgctactcggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcaccccgatatttttactgcggcgacattttcggcgccc
atgtatggcattaaattacctatgcccaaagggttcgtgcgttggttagccagtaaactc
gataccacactcaatggcggcgagcctaattatgtgcttgcaggacaaaactataaacct
gttccattcaaagggaatgagctaactcacagccaaacccgataccaagcctaccgagaa
ttgtatgatgccgcgcctaagttacaactcggttcacccactaaccgttggttgactgaa
tctttagatgccgcagatacttgcgtactggcaacggcacaaattcgcactccgatactg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatctcgccgtgagt
acccattgccaattgaaagtaatcgctggggctgcccatgagatttttatggaaaaagac
gcctgccgaaaccaagccttaaactatgcactcgatttttttaaacgctacgcaacaaag
aattcgaatggaaaagttgtttaa

DBGET integrated database retrieval system