KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0277Help
Entry
SPD_0277          CDS       T00413                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPD_0277 (celA)
Enzymes [BR:spd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPD_0277 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274549..275985
Genome map
AA seq 478 aa AA seqDB search
MTTFKDGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVAREITLGVLEGKYYPNH
EAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNEEGLQFYDNLFDECLKN
GIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKRYKDKVKYWMTFNEINNQ
ANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAVKIGHEINPDFQIGCMIAM
CPIYPVTCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFKYWERKGISVDFTDQDKEDL
LGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNNYVKASEWEWQIDPEGLRYAL
NWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYLGAHIREMKKAVVEDGVDLMGY
TPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRSPKKSFGWYKEVISSNGESVE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactacttttaaagatggatttttatggggtggtgctgttgctgctcatcaacttgaa
ggtggatggcaagaaggtggcaagggaattagtgttgctgatgttatgactgctggtcgt
catggagtagctcgtgaaattactttgggagttttagagggtaaatattatccaaatcat
gaggcgatagatttttatcatcgttataaagaagacatagcactttttgctgaaatggga
ttcaagtgcttccgtacctctattgcatggacacgtatctttccaaaaggtgatgagtta
gagccgaatgaagaaggattacagttttatgataatctttttgatgaatgcttaaagaat
ggtattgaacctgtcatcactctatctcattttgaaatgccttatcacttagtgaccgaa
tatggtggttggaaaaataggaaattgattgatttctttgctcgttttgcagaagtcgta
tttaaacgttacaaagataaggttaaatattggatgactttcaatgaaatcaataatcaa
gcgaattatcaggaagattttgcaccatttactaactcaggtattgtatatgaggaaggt
gataatagagaagcaattatgtatcaagcagcacattacgaattagttgcttctgcacga
gctgtaaaaattggtcatgagattaatccagattttcaaataggttgtatgattgcgatg
tgtccaatttatccagttacttgcaatcctaaggatatcttaatggcaatgaaagctatg
cagaagcgttattattttgctgatgtgcatgttttaggtaaatatcctgagcatattttc
aagtattgggaacgaaaaggtatttcagttgattttactgaccaggataaagaagattta
cttggtgggactgtagattacattggtttcagttactatatgtcctttgctatagactct
catcgtgaaaataatccttattttgattatcttgaaacagaagatttagtgaaaaataat
tatgttaaggcttctgaatgggagtggcaaattgatccagaaggtttacgttatgcgtta
aattggtttacagaccactatcacttaccactctttattgttgaaaatggttttggagct
atagatcaagttgcagcagatggtatggtacatgatgattatagaattgaatatctaggt
gcccatattcgtgaaatgaaaaaggctgtagttgaagatggtgttgatttaatgggttat
actccatggggatgtattgatttggtttcagctggtaccggtgaaatgcggaaacgttat
ggctttatttatgtagataaagatgacaatgggaagggaagttataatcgttccccgaaa
aaatcttttggctggtataaggaagttatttcatctaacggtgaatcagtagaatag

DBGET integrated database retrieval system