KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0366Help
Entry
SPD_0366          CDS       T00413                                 

Definition
helicase, RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPD_0366
Enzymes [BR:spd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPD_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(368804..371170)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
IRILEKGEQKRQDLETIQKHITTVEQELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDAEFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KRDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDSNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQ
HIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDRIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatcgacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcgca
aaaccaactagtaagggcttggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtggatacctatggcgaaaataccattgacgaaattttg
caacacccagaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggtacggagatggttttggccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggtatccgcagtcacttg
attcgtatccttgaaaaaggagaacagaagagacaagatttagaaactattcaaaagcat
atcactactgtcgagcaagaactggggattgagtatgataacattcaaaaacaagctatt
tgtgacgctatccagaacaaggtctttatcctgacaggtgggcctggtactggtaagaca
actgttatcaatggaatcatcgctgtttatgcccttttagaaggacttgacttcaggaag
aaaagcaatctgcccattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacatcgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgagtttatcatcgtggatgaattctct
atggtagatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctgcttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcaaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcccgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgtcactatcgt
aagagagacaaggtcattcatttggttaacgatgctgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatagtaatgaagtctcttacccccgtaacgaatggtacaagattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgactatgctacccaa
cacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgatctactggagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggaccgcatcccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system