KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0580Help
Entry
SPD_0580          CDS       T00413                                 

Gene name
gki
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPD_0580 (gki)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPD_0580 (gki)
   00052 Galactose metabolism
    SPD_0580 (gki)
   00500 Starch and sucrose metabolism
    SPD_0580 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SPD_0580 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPD_0580 (gki)
   00524 Butirosin and neomycin biosynthesis
    SPD_0580 (gki)
Enzymes [BR:spd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPD_0580 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607682..608641
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactcggt
actggtgttggtggcggtatcgtcgcagaaggcaaattgcttcacggtgttgctggtgca
gcaggtgagcttggtcacatcactgttgactttgaccagccaatctcatgtacttgtggt
aaaaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system