KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0635Help
Entry
SPD_0635          CDS       T00413                                 

Definition
cation-transporting ATPase, E1-E2 family protein (EC:3.6.3.4)
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Brite
Enzymes [BR:spd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     SPD_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
654526..656769
Genome map
AA seq 747 aa AA seqDB search
MTEIVKASLENGIQKIRIQAEKGYHPAHIQLQKGIPAEITFHRATPSNCYKEILFEEEGI
LEPIGVDEEKVIRFTPQELGRHEFSCGMKMQKGSYTVVEKTRKSLSLLQRFWITSIFTVP
LVILMIGMLTGSISHQVMHWGTFLATTPIMLVAGKPYIQSAWASFKKHNANMDTLVALGT
LVAYFYSLVALFAGLPVYFESAGFILFFVLLGAVFEEKMRKNTSQAVEKLLDLQAKTAEV
LSDDSYVQVPLEQVKVGDLIRVRPGEKIAVDGVVVEGVSSIDESMVTGESLPVDKTVGDT
VIGSTINHSGTLVFRAEKVGSETVLAQIVDFVKKAQTSRAPIQDLTDKISGIFVPVVVIL
GIMTFWVWFVLLRDSVVVLGASFVSSLLYGVAVLIIACPCALGLATPTALMVGTGRSAKM
GVLLKNGTVLQEIQKVQTLVFDKTGTLTEGKPVVTDIIGDEVEVFGLAASLEDASQHPLA
EAIVKRASEAGLEFQTVENFQALHGKGVSGRINGKQVLLGNAKMLDGMDISNTYQDKLEE
LEKEAKTVVFLAVDNEIKGLLALQDIPKENAKLAISQLKKRGLRTVMLTGDNAGVARAIA
DQIGIEEVIAGVLPEEKAHEIHKLQAAGKVAFVGDGINDAPALSVADVGIAMGAGTDIAI
ESADLVLTTNNLLGVVRAFDMSKKTFHRILLNLFWAFIYNVVGIPIAAGVFSGVGLALNP
ELAGLAMAFSSVSVLTSSLLLNFSKID
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattgtgaaagcaagcttagaaaatggcattcaaaaaatccgtatccaagct
gaaaaaggctatcatccagcccatatccagcttcaaaagggaattccagctgagattacc
tttcatcgtgctactccttcaaactgttataaggaaattctgtttgaagaagaaggtatc
ttggaaccaatcggcgtagatgaggagaaagtcattcgttttacacctcaagaattaggg
cgacatgaattttcttgtggcatgaagatgcaaaagggaagctatacagtcgttgagaag
actcgaaaatctctatctctcctgcaacgtttttggattactagtatctttactgtgcct
cttgtgattctcatgattgggatgttgacaggtagcattagtcatcaagtcatgcattgg
ggaacctttctagcaacaacgcctattatgttagttgcaggtaagccatatatccagagt
gcttgggccagttttaaaaagcacaatgccaacatggataccttggttgcgctgggaact
ctagtggcttatttctatagcctagttgctctctttgctggtctccctgtttacttcgaa
agtgctggatttatcctctttttcgttcttttgggagcagtttttgaggaaaaaatgaga
aaaaatacgtcccaagctgtggagaaattactggacttgcaagctaaaaccgcagaagtc
ttgagtgatgatagttatgtccaagttcctttggaacaagtcaaggtaggcgacctgatt
cgagtgcgtcccggtgaaaagattgctgttgatggtgtcgtagtagaaggtgtctctagt
attgacgaatccatggtgacaggtgagagtctgcctgtggacaagacagttggagatact
gtcattggctcaaccatcaatcatagtggaacgcttgtctttagagcagaaaaagttggc
tcagagactgttttggctcagattgtggattttgtgaagaaagctcagacaagtcgtgcg
ccgattcaggacttgacggataagatttcagggatttttgtcccagtagttgtcatttta
ggaatcatgaccttttgggtttggttcgtcttgctcagggatagtgtggtcgtgcttgga
gctagctttgtgtcctctcttctctacggagtggcggttttgattatcgcctgtccttgt
gccttgggacttgcaacaccgacagcccttatggtggggacaggacgtagtgccaagatg
ggggttctcctcaaaaatggaactgtcttacaggaaatccagaaagttcaaactcttgtc
tttgataagaccgggactttgacggaagggaaacctgtggtaacagatatcatcggcgac
gaagtagaagtgtttggattggcagcctccttggaagatgcttctcaacacccactggct
gaggctatcgttaagcgagcgagtgaagctggacttgagtttcaaactgttgaaaatttt
caggccttgcacgggaaaggtgtttcagggcgaatcaatggaaaacaagttttacttgga
aatgctaaaatgctggatggcatggatatttctaatacttatcaagataaactagaagaa
ctagaaaaagaagctaagacagttgtgtttttagctgttgacaatgaaatcaaaggcttg
cttgctttgcaagatattcctaaggaaaatgctaagctagccatcagtcagctaaaaaaa
cgtggtctccgaacagtcatgctgacaggagacaatgctggtgtggcgcgtgctattgca
gatcaaatcggaattgaagaggtcattgcaggcgtcttgccagaagaaaaagcccatgaa
atccataaactgcaagcggctggcaaagtagcctttgttggggacggtatcaatgacgct
cctgcccttagtgtagcagatgtgggaattgctatgggtgctggaacagatatcgccatc
gagtcagcagatttggtgttgacaaccaataatcttttaggagtggttcgtgcctttgat
atgagtaagaaaacctttcatcgaattctactcaatcttttctgggcttttatctacaat
gttgtcggaattccgattgcagcaggagtcttttcaggtgttggactggctctcaaccca
gaattggcaggtctagccatggcctttagttctgtatctgttctgaccagttcccttctg
ttaaattttagtaaaatagactaa

DBGET integrated database retrieval system