KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0790Help
Entry
SPD_0790          CDS       T00413                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00010  Glycolysis / Gluconeogenesis
spd00230  Purine metabolism
spd00620  Pyruvate metabolism
spd01100  Metabolic pathways
spd01110  Biosynthesis of secondary metabolites
spd01120  Microbial metabolism in diverse environments
spd01130  Biosynthesis of antibiotics
spd01200  Carbon metabolism
spd01230  Biosynthesis of amino acids
Module
spd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spd_M00002  Glycolysis, core module involving three-carbon compounds
spd_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
spd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPD_0790 (pyk)
   00620 Pyruvate metabolism
    SPD_0790 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    SPD_0790 (pyk)
Enzymes [BR:spd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SPD_0790 (pyk)
Membrane trafficking [BR:spd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPD_0790 (pyk)
Exosome [BR:spd04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPD_0790 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABJ55166
UniProt: A0A0H2ZQE0
Position
807774..809279
Genome map
AA seq 501 aa AA seqDB search
MNKRVKIVATLGPAVEIRGGKKFGEDGYWGEKLDVEASAKNIAKLIEAGANTFRFNFSHG
DHQEQGERMATVKLAEKIAGKKVGFLLDTKGPEIRTELFEGEAKEYSYKTGEKIRVATKQ
GIKSTREVIALNVAGALDIYDDVEVGRQVLVDDGKLGLRVVAKDDATREFEVEVENDGII
AKQKGVNIPNTKIPFPALAERDNDDIRFGLEQGINFIAISFVRTAKDVNEVRAICEETGN
GHVQLFAKIENQQGIDNLDEIIEAADGIMIARGDMGIEVPFEMVPVYQKMIIKKVNAAGK
VVITATNMLETMTEKPRATRSEVSDVFNAVIDGTDATMLSGESANGKYPLESVTTMATID
KNAQALLNEYGRLDSDSFERNSKTEVMASAVKDATSSMDIKLVVTLTKTGHTARLISKYR
PNADILALTFDELTERGLMLNWGVIPMLTDAPSSTDDMFEIAERKAVEAGLVESGDDIVI
VAGVPVGEAVRTNTMRIRTVR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgtaaaaatcgttgcaactttgggtcctgcggtagaaatccgtggtggt
aaaaaattcggtgaggacggatactggggtgaaaaacttgatgttgaagcttcagctaaa
aacattgctaaattgattgaagctggtgctaacacattccgattcaacttctcacacggc
gaccaccaagaacaaggtgagcgtatggcaactgttaaacttgcggaaaaaattgcaggt
aaaaaagttggtttccttcttgatacaaaaggacctgaaatccgtacagaattgttcgaa
ggtgaagctaaagaatattcatacaaaactggtgaaaaaattcgtgttgcaactaaacaa
ggaatcaaatcaactcgtgaagtgattgcgttgaacgttgctggtgctcttgatatctat
gatgatgttgaagttggtcgtcaagttttggttgacgatggtaaacttggtcttcgtgtg
gttgctaaagatgatgcaactcgtgaatttgaagttgaagttgaaaacgatggtatcatc
gctaaacaaaaaggtgtgaacatccctaacactaaaattcctttcccagctcttgctgaa
cgcgataacgacgatatccgtttcggtcttgaacaaggtatcaacttcatcgcaatttca
ttcgtacgtactgcaaaagatgtgaacgaagttcgtgcaatctgtgaagaaactggaaac
ggacatgttcaattgttcgctaaaatcgaaaaccaacaaggtatcgataacttagacgaa
atcatcgaagcagctgatggtattatgattgctcgtggtgatatgggtatcgaagtaccg
ttcgaaatggttccagtttatcaaaaaatgattatcaagaaagtcaatgctgcaggtaaa
gttgttatcactgcaacaaacatgcttgaaacaatgactgaaaaaccacgtgcaactcgt
tcagaagtatcagacgtattcaacgctgttatcgacggaactgacgctacaatgctgtca
ggcgagtctgcaaacggtaaatacccactcgagtcagtaactacaatggctacaatcgac
aagaacgctcaagctcttcttaatgaatacggacgtcttgattcagattcatttgagcgt
aactctaagacagaagtaatggcttctgctgttaaagatgctactagctcaatggatatc
aaattggttgtaactcttactaagacaggtcatactgcacgtttgatttctaaataccgt
ccaaatgctgacatcttagcattgacatttgacgaattgacagaacgtggcttgatgttg
aactggggtgttatcccaatgttgacagatgctccatcttcaactgacgatatgttcgaa
atcgctgaacgtaaagcggtagaagcaggtctcgttgagtcaggcgatgatatcgttatc
gttgctggtgtgccagtaggagaagctgttcgcacaaacacaatgcgtatccgcacagta
cgttaa

DBGET integrated database retrieval system