KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0822Help
Entry
SPD_0822          CDS       T00413                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840495..841604
Genome map
AA seq 369 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDELKVGDNDTLSAQVAAMVQADLLVFLTDVDGLYTGNPNS
DPRAKRLERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDS
MIEAAEETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGI
VEAEGVFSYGDIVTVFDKESGKSLGKGRVQFGASALEDILRSQKAKGVLIYRDDWISITP
EIQLLFTEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtagggcaggga
cttttgttggaagaatatacgaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgagctcaaggttggggacaatgacactctaagtgctcaagtagcggcgatggtccaa
gcagaccttttagttttcttgacagatgtggacggtctctatactggaaatcctaattca
gatccaagagccaaacgcttggagagaatcgagaccatcaatcgtgagattattgatatg
gctggtggagctggttcgtcaaacggaactgggggtatgttaaccaaaatcaaggctgca
actatcgcgacggaatcaggagttcctgtttatatctgctcatccttgaaatcagattcc
atgattgaggcggcagaggagaccgaggatggttcttactttgttgctcaagagaagggg
cttcgtacccagaaacaatggcttgccttctatgctcagagtcaaggttctatttgggtt
gataaaggggctgcggaagctctctctcaacatggaaagagtcttctcttatctggtatc
gttgaagcagaaggagtcttttcttacggtgatatcgtgacagtatttgataaggaaagt
ggaaaatcacttggaaaaggacgcgtgcaatttggagcatctgctttggaggatatattg
cgttctcaaaaagccaagggtgtcttgatttaccgtgacgactggatttccattactcct
gaaatccaactactttttacagaattttag

DBGET integrated database retrieval system