KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_0904Help
Entry
SPD_0904          CDS       T00413                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPD_0904 (tdk)
Enzymes [BR:spd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPD_0904 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916739..917338
Genome map
AA seq 199 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPMITSNKEQNYDN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtactatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacctcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttcttaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcggacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcgccaatgataacctctaacaaggagcaaaactatgacaattga

DBGET integrated database retrieval system