KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1005Help
Entry
SPD_1005          CDS       T00413                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1017799..1019727
Genome map
AA seq 642 aa AA seqDB search
MDNREALKTFMTGENFYLQHYLGAHREELNGEHGYTFRVWAPNAQAVHLVGDFTNWIENQ
IPMVRNDFGVWEVFTNMAQEGHIYKYHVTRQNGHQLMKIDPFAVRYEARPGTGAIVTELP
EKKWKDGLWLARRKRWGFAERPVNIYEVHAGSWKRNPDGSPYSFAQLKDELIPYLVEMNY
THIEFMPLMSHPLGLSWGYQLMGYFALEHAYGRPEEFQDFVEECHTHNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHNKAHNHGWGALNFDLGKNEVQSFLISCIKHWIDVYHLDG
IRVDAVSNMLYLDYDDAPWTPNKDGGNLNYEGYYFLQRLNEVIKLEYPDVMMIAEESSSA
TKITGMKEIGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYVFKENYLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEYGQFLEWKSEEQ
LEWSNLEDPMNAKMKYFTSQLNQFYKDHRCLWEIDTSYDGIEIIDADNRDQSVLSFIRKG
KKGEMLVCIFNMVPVERKDFTIGLPVAGIYEEVWNTELEEWGGVWKEHNQTVQTQEGLWK
DYEQTLTFTLPAMGASVWKIKRRLKSTKTVTNKNPKGVENEK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggataatagagaagcattaaaaacctttatgacgggtgaaaatttttatctccaacat
tatctaggagcacatagggaagaactaaatggagagcatggctataccttccgtgtttgg
gcacctaatgctcaggctgttcacttggttggtgattttaccaactggattgaaaatcag
attccaatggtaagaaatgattttggggtctgggaagtctttaccaatatggctcaagaa
gggcatatttacaaatatcatgtcacacgtcaaaatggtcatcaactgatgaagattgac
ccttttgctgtcaggtatgaggctcgtccaggaacaggggcaatcgtaacagagcttcct
gagaagaaatggaaggatggactttggctggcacgaagaaaacgttggggctttgctgaa
cgtcctgtcaatatttacgaggttcatgctggctcttggaagagaaatcctgatggcagt
ccttatagttttgcccaattgaaagatgaactcattccttacctagttgagatgaactat
actcatattgagtttatgcccttgatgtcccacccactaggtttgagttgggggtaccag
cttatgggttacttcgctttagagcatgcctatggtagaccagaggagtttcaagatttt
gtcgaggagtgtcatacccataatattggggttattgtggactgggtaccaggtcacttt
accatcaatgatgatgccttagcctattatgatgggacaccgacttttgaataccaagac
cataataaggctcataaccatggttggggtgcccttaattttgaccttggaaaaaatgaa
gtccagtccttcttaatttcttgcattaagcattggattgatgtctatcatttggatggt
attcgtgtggatgctgttagcaacatgctctatttggactatgatgatgctccatggaca
cctaataaagatggcggaaatctcaactatgaaggttattatttccttcaacgcttgaat
gaagttattaagttagaatatccagatgtgatgatgattgcagaagaaagttcgtctgca
accaagattacgggaatgaaagagattggtggtctaggatttgactacaaatggaacatg
ggctggatgaatgatatcctccgtttctacgaagaagatccgatttatcgtaaatatgac
tttaacctggtgactttcagctttatgtatgttttcaaggagaattatctcttgccattc
tcgcacgatgaagtggttcatggcaagaagagtatgatgcataagatgtggggagatcgt
tacaatcaattcgcaggcttgcgcaatctctatacgtaccaaatttgtcaccctggtaag
aaattgctcttcatgggtagcgaatacggtcaattcctagaatggaaatctgaagaacag
ttggaatggtctaacctagaagacccaatgaatgctaagatgaagtatttcacttctcag
ctaaaccagttttacaaagatcatcgctgtctgtgggaaatcgataccagctatgatggt
attgaaatcattgatgcggataatcgagaccagagtgttctttcctttattcgtaagggt
aaaaagggagaaatgttagtctgtatctttaacatggtacctgttgagcggaaagatttt
acaatcggactacccgttgcaggaatttacgaagaagtatggaatactgagttggaagag
tggggaggcgtttggaaagaacataatcaaactgttcaaacgcaagaaggactatggaaa
gattatgagcagaccttaacctttaccctaccggctatgggagcaagtgtatggaaaatc
aaacgtcgcttgaaatctactaaaaccgtcacaaataaaaacccaaaaggagtagaaaat
gaaaaatga

DBGET integrated database retrieval system