KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1597Help
Entry
SPD_1597          CDS       T00413                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00260  Glycine, serine and threonine metabolism
spd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spd01100  Metabolic pathways
spd01110  Biosynthesis of secondary metabolites
spd01130  Biosynthesis of antibiotics
spd01230  Biosynthesis of amino acids
Module
spd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPD_1597 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPD_1597 (trpB)
Enzymes [BR:spd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPD_1597 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ54918
UniProt: Q04IY9
Structure
PDB: 

Jmol
Position
complement(1612842..1614065)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECIIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSTLGPHPFPEIVRDFQSVIGREAKQQYRDLTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaagaaccaaataaagatggattttacggaaaatttggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaacttttgcgccagtatgtgggacgtgaaact
cccctttactacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcagccctctttaatatggaatgtatcatctacatgggtgag
gaagatgtcaaacgccaagctctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtagctaatatcgatgatacccactatatccttggttctaccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggacaaaatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgccatcggtctcttccatccctttgtagaagatgagtctgtagctatgtatggggct
gaagcagctggacttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system