KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1597Help
Entry
SPD_1597          CDS       T00413                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:spd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:spd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1612842..1614065)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECIIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSTLGPHPFPEIVRDFQSVIGREAKQQYRDLTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaagaaccaaataaagatggattttacggaaaatttggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaacttttgcgccagtatgtgggacgtgaaact
cccctttactacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaacgggtgctggtcagcacggt
gtggcaactgcaactgctgcagccctctttaatatggaatgtatcatctacatgggtgag
gaagatgtcaaacgccaagctctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtagctaatatcgatgatacccactatatccttggttctaccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgagaggctaaacaacagtac
cgtgacttgacaggacaaaatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgccatcggtctcttccatccctttgtagaagatgagtctgtagctatgtatggggct
gaagcagctggacttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagccttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system