KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1877Help
Entry
SPD_1877          CDS       T00413                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:spd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:spd00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:spd00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1855330..1856814)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLNFNKLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGDKINFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALNSQGQYELT
NFDAEILDLFAAEYATEEETAAEIKRVYESDSYIEDPHTAVASAVYRKYQATTGDATKTV
IASTASPYKFPVVAVEALTGKVGLTDFEALAQLHEISGVAVPPAVDGLETAPVRHKTIVA
AADMQVAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttgaactttaacaaattgaaagatgcttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagctgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcaaactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggtcaagactggtgagatcgtggctggtgataagatt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
atcggtctcccagttggtaaattgatctgtgcttcaaatgacaacaatgttttgacagac
ttcttcaagacacgtgtctatgacaagaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgtttgattttccatcttttggggaatgat
gcggttaagacggctgaactcatgaatgctttgaatagccaaggtcaatatgagttgact
aattttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaact
gcggcagaaatcaagcgtgtttatgagtcagattcttatatcgaggatcctcatacagcg
gttgcctcagcagtgtatagaaaataccaggcgactactggagatgcgactaagacagtg
attgcttcaacagctagtccctacaagttcccagtagttgcagtagaagcgctaacaggg
aaagttggcttgactgattttgaagctttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgagacagctcctgttcgtcacaagacaatagtggca
gctgctgacatgcaagtagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system