KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1919Help
Entry
SPD_1919          CDS       T00413                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPD_1919 (galU)
   00052 Galactose metabolism
    SPD_1919 (galU)
   00500 Starch and sucrose metabolism
    SPD_1919 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SPD_1919 (galU)
Enzymes [BR:spd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPD_1919 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888288..1889187
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYKRTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFQILENQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagttatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaggctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccacttcgattcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaacagatcttttgaagctagttgatgaaacaactggcatgcgtctgcat
tttatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacaagcgtacccacgcgtctact
atcgctgtcatgccagtccctcatgacgaagtatctgcttacggggttattgctccgcaa
ggcgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctccagag
gacgctcctagcgaccttgctattatcggacgctacctcctcacgcctgaaattttccaa
atcctcgaaaaccaagctcctggtgctggaaatgaaatccaacttactgatgcaatcgat
actcttaataaaacacagcgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggggataagtttggctttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system