KEGG   Streptococcus pneumoniae D39 (virulent serotype 2): SPD_1969Help
Entry
SPD_1969          CDS       T00413                                 

Definition
(GenBank) glycosyl hydrolase-related protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
spd  Streptococcus pneumoniae D39 (virulent serotype 2)
Pathway
spd00511  Other glycan degradation
spd00520  Amino sugar and nucleotide sugar metabolism
spd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPD_1969
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPD_1969
Enzymes [BR:spd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPD_1969
Chaperones and folding catalysts [BR:spd03110]
 Intramolecular chaperones
  Others
   SPD_1969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: ABJ54174
UniProt: A0A0H2ZNK8
Structure
PDB: 

Jmol
Position
complement(1937402..1939282)
Genome map
AA seq 626 aa AA seqDB search
MVRFTGLSPKQTQAIEVLKGHISLPDVEVAVTQSDQASISIQGEEGHYQLTYRKPHQLYR
ALSLLVTVLAEADKVEIEEQAAYEDLAYMVDCSRNAVLNVASAKQMIEVLALMGYSTFEL
YMEDTYQIEGQPYFGYFRGAYSAEELQEIEAYAQQFDMTFVPCIQTLAHLSAFVKWGVKE
VQELRDVEDILLIGEEKVYDLIDGMFATLSKLKTRKVNIGMDEAHLVGLGRYLILNGVVD
RSLLMCQHLERVLDIADKYGFHCQMWSDMFFKLMSADGQYDRDVKIPEETRVYLDRLKDR
VTLVYWDYYQDSEEKYNRNFRNHHKISHDLAFAGGAWKWIGFTPHNHFSRLVAIEANKAC
RANQIKEVIVTGWGDNGGETAQFSILPSLQIWAELSYRNDLDGLSAHFKTNTGLTVEDFM
QIDLANLLPDLPGNLSGINPNRYVFYQDILCPILDQHMTPEQDKPHFAQAAETLANIKEK
AGNYAYLFETQAQLNAILSSKVDVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHA
LFSHQWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLAGQLDRIDELEVEILPFTDF
YADKDFAATTANQWHTIATASTIYTT
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggtaagatttacaggacttagtcccaaacaaacgcaagctattgaggttttaaaaggt
catatttctctaccagatgtggaagtggctgtcactcagtctgaccaagcctctatctct
atccagggtgaggaaggtcactatcaattgacctaccgcaaacctcaccaactctatcgt
gccttatccttgttggtaacagttctagcagaagctgataaagtagagattgaggaacaa
gcagcttacgaagatttggcttacatggttgactgttctcgaaatgcggtgctgaatgtg
gcttctgccaagcagatgattgaggtcttggctctcatgggctactcaacctttgagctt
tacatggaagacacttaccagattgaagggcaaccttactttggctatttccgtggagct
tattcagcagaggagttgcaggaaatcgaagcctatgcccaacagtttgacatgaccttt
gtaccatgcatccagaccttggcccacctgtcagcctttgtcaaatggggtgtcaaggaa
gtgcaggagctccgtgatgtagaggacattcttctcattggcgaagaaaaggtttatgac
ctgattgatggcatgtttgccacgttgtctaaactgaagactcgcaaggtcaatatcggg
atggacgaagcccacttggttggtttgggacgctacctgattctgaacggtgttgtggat
cgtagtctcctcatgtgccaacacttggagcgcgtgctggatattgctgacaaatatggt
ttccactgccagatgtggagtgatatgttcttcaaactcatgtcagcggatggccagtac
gatcgtgatgtgaaaattccagaggaaactcgtgtctacctagaccgtctcaaagaccgt
gtgactctggtttactgggattattatcaggatagcgaggaaaaatacaaccgtaatttc
cgcaatcatcacaagattagccatgaccttgcatttgcagggggagcttggaagtggatt
ggctttacacctcacaaccattttagccgtctagtggctatcgaggctaataaagcctgc
cgtgccaatcagattaaagaagtcatcgtaacgggttggggagacaatggtggtgaaact
gcccagttctctatcctaccaagcttgcaaatctgggcagaactcagctatcgcaatgac
ctagatggtttgtctgcgcacttcaagaccaatactggtctaacggttgaggattttatg
cagattgaccttgccaacctcttaccagacctaccaggcaatctcagcggtatcaatccc
aaccgctatgttttttatcaggatattctttgtccgattcttgatcaacacatgacacct
gaacaggacaaaccgcacttcgctcaggctgctgagacgcttgctaacattaaagaaaaa
gctggaaactatgcctatctctttgaaactcaggcccagttgaatgctattttaagtagc
aaagtagatgtgggacgacgcattcgtcaggcctaccaagcggatgataaagaaagttta
caacaaatcgccagacaagaattaccagaacttagaagccaaattgaagacttccatgcc
ctctttagtcaccaatggctgaaagaaaacaaggtctttggtttggatacagttgacatc
cgtatgggcggactcttgcaacgcatcaaacgagcagaaagccgtatcgaggtttatctg
gctggtcagcttgaccgcatcgacgagctggaagttgaaatcctaccatttactgacttc
tacgcagacaaggatttcgcagcaactacagccaaccagtggcataccattgcgacagcg
tcgacgatttatacgacttaa

DBGET integrated database retrieval system