KEGG   Serratia proteamaculans: Spro_0098Help
Entry
Spro_0098         CDS       T00595                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
spe  Serratia proteamaculans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spe00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(104720..106039)
Genome map
AA seq 439 aa AA seqDB search
MQSYFDQLEQVHYEGPTSNNPLAFHHYNPDELVLGKRMAEHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGDALTLAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLHNFA
VMTDVLEEKQHSSGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATQRL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DPQLGWDTDQFPISVEENALVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAAKMVTDGQLHQQVSKRYAGWNGELGQQILQGKLSLEALAQYAEGHALAPQ
HVSGRQEQLENLMNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattttgatcagcttgagcaagtgcactacgaaggccccaccagtaataat
ccgctggcctttcatcattacaatccggatgaactggtgctcggcaagcgcatggcggag
cacctgcgctttgccgcctgctactggcacaccttctgctggaacggggcggacatgttc
ggcgtcggctcgttcgatcgcccctggcagcagccgggcgacgcgctgacgttagccaaa
cgtaaggccgacgtggcgttcgagttttttcacaagctgaacgttccctattactgcttc
catgacgtcgacgtctcgccggaaggcgcctcgctgaaagaatacctgcacaactttgcg
gtcatgaccgacgtgctggaagaaaaacaacacagcagcggggtaaaactgctgtggggc
accgccaactgctttacccatccgcgttacggtgccggtgcggccaccaacccggatccg
gaagtcttcagttgggcggctacccaggtgttcaccgccatgaacgccacccagcgtctg
ggcggtgaaaactacgtgctttggggcggccgcgaaggctatgaaaccttgctgaatacc
gatctgcgccaggagcgtgagcaaattggccgctttatgcagatggtggtggagcacaag
cacaaaaccggtttccagggcaccctgctgatcgagccaaaacctcaggagccgaccaag
catcaatacgattacgacgtcgccaccgtgtacggcttcctcaagcagtttggcctggag
aaagagatcaaggtgaatatcgaagccaaccacgccacgctggcaggccactcgttccac
catgagatagccaccgccattgcgctcggcatctttggttccgtcgatgccaaccggggc
gacccacagttgggctgggataccgaccagttcccgatcagcgtggaagagaacgcgctg
gtgatgttcgaaattctcaaggccgggggctttaccaccggcgggctgaacttcgatgcc
aaggtacgccgtcaaagcaccgacaaatacgacctgttctatggccatattggggctatg
gataccatggcactggcgctgaaggtcgcggctaaaatggtgactgacggccagttacat
cagcaggtatcaaaacgctatgccggctggaatggtgaattgggccagcaaattttgcag
ggcaaactgtcgctcgaggcgctggcgcagtacgctgaaggacatgcactggcgccacag
cacgtcagcggccgccaggaacagcttgaaaacctgatgaaccgctatctgttcggctaa

DBGET integrated database retrieval system