KEGG   Serratia proteamaculans: Spro_0150Help
Entry
Spro_0150         CDS       T00595                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
spe  Serratia proteamaculans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spro_0150
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Spro_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
163917..165029
Genome map
AA seq 370 aa AA seqDB search
MPAALKRLTFGMLLLCSFSAVATCEWPAWQQYKQFYISEQGRVIDPSSPNRITTSEGQSY
GLFFALVANDRPAFDQLLTWTENNLAAGDLSAHLPAWLWGEDDKKQWTVLDSNSASDSDL
WIAYNLLEAGRLWKSRRYQTLGTLLLQRIAREEVADIPGLGLMLLPGKVGFVAEDRWRLN
PSYLPPQLLARFAALNGPWRAMQQTNQRLWLETAPYGFLPDWVVWQVGKGWQPDTVKPNI
GSYDAIRAYLWAGMLADDDQHKAALLKQLQPMAQLTVQQGVPPEKTDTASGKTMGNGPVG
FSASMLPMLANQPEALQVQRQRIKQNPPGDNAYFSASLALFGQGWDQQRYRFNRQGELQP
SWGGQCVTSE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcggcattgaagcgtctgaccttcggcatgttgctactgtgctcattcagcgcg
gtagccacctgcgagtggccagcctggcaacagtacaaacagttttatatcagcgagcag
gggcgggtgatcgatccgagtagcccgaatcgaatcacgacctcggaaggccagagttat
ggcctgttcttcgcgctggtggccaacgatcgacctgctttcgaccaactgctgacgtgg
acggaaaataatctggcggcgggcgatctcagcgcccatttgccggcctggctatggggt
gaggacgataaaaagcagtggacggtgctggacagtaattcggcctccgattccgatctg
tggattgcctataacctgctggaggcggggcgcctgtggaaaagccgtcgctatcaaact
ctcggtaccctgctgctgcagcggattgcccgtgaagaagtggctgatattcccggcctg
gggctgatgttgttaccgggtaaggtggggtttgtggcggaagatcgctggcggctcaac
ccaagctatctgccgccgcaactgttggcgcgttttgccgcgttgaacggcccatggcgt
gcgatgcagcaaactaatcagcggctatggctggagacggccccttacggcttcttgccg
gactgggtggtgtggcaggtgggcaaaggctggcaaccggacaccgtcaagccgaacatc
ggcagttacgacgccatccgggcctatttgtgggccggtatgctggcagacgacgatcaa
cacaaggcggcgctgctcaagcagttgcaacctatggcacagctcaccgttcaacagggc
gtgccgccggagaaaaccgacaccgccagcggcaaaaccatgggtaacggcccggtaggt
ttttctgcctcgatgttgccgatgctggccaatcaacccgaggcgttacaggtacaacgc
caacgcattaagcaaaacccgccgggcgacaacgcctatttcagcgcctcgctggcgctg
tttggccagggatgggatcaacaacgttatcgttttaatcggcagggtgaacttcaaccc
tcctggggcggccaatgcgtaacttccgaataa

DBGET integrated database retrieval system