KEGG   Serratia proteamaculans: Spro_0192Help
Entry
Spro_0192         CDS       T00595                                 

Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
spe  Serratia proteamaculans
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Spro_0192
   00565 Ether lipid metabolism
    Spro_0192
   00590 Arachidonic acid metabolism
    Spro_0192
   00591 Linoleic acid metabolism
    Spro_0192
   00592 alpha-Linolenic acid metabolism
    Spro_0192
Enzymes [BR:spe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Spro_0192
    3.1.1.32  phospholipase A1
     Spro_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
216024..216902
Genome map
AA seq 292 aa AA seqDB search
MRILSGFILATLAAAPLAQAEEAKEQQIHDKPAVRGSIIANMLQDHDNPFTLYPYDTNYV
LYTDTSNINKEAIQSYNWADNARKDEVKFQLSLAFPLWRGIAGDNSVLGASYTQRSWWQL
SNHSESSPFRETNYEPQVFLGWATDYSFAGWTLRDVEVGLNHQSNGRSDPTSRSWNRGYA
RFMAQNGNWQVDLKPWFRFSESDSSDDNPDITKYMGYYRLKVGYAWGDSVFSVDSHYNWN
SGYGGAELGWSYPISKHVRFYTQVFSGYGESLIDYNFRQTRVGVGVMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattttgtcagggttcattttggccacgctggcggcggctccgctggctcaggcg
gaagaagccaaagagcagcaaattcatgataaaccggcggtgcgcggcagcattattgcc
aatatgctgcaggatcacgacaacccattcacgctgtatccgtatgacaccaactatgtg
ctgtataccgataccagcaatatcaacaaagaggccatccagtcctataactgggccgat
aatgcccgcaaggacgaggtcaaattccaactcagcctggcgttcccactgtggcgtggc
attgccggtgataactcggtgctgggcgcgtcttatactcagcgctcctggtggcagctt
tccaaccacagtgagtcatccccgttccgtgagaccaactacgaaccgcaggtgttcctg
gggtgggcgaccgattacagcttcgccggctggacgctgcgtgacgttgaagtgggcttg
aatcaccagtccaacggccgttctgatcccacttcacgcagctggaaccggggttatgcg
cgctttatggcacaaaacggcaactggcaggtggatctcaagccctggttccgcttttcg
gaaagcgacagcagtgacgataacccggacatcaccaaatacatgggctattaccgtctg
aaagtgggctatgcctggggtgacagcgtgttcagtgtcgacagccattacaactggaac
agcggttatggcggcgcggaattaggctggagctacccgatcagcaagcacgtgcgtttc
tacactcaggtgttcagcggttacggcgaatccttgattgattacaacttccggcagaca
cgggttggcgttggtgtcatgcttaacgatattatgtaa

DBGET integrated database retrieval system