KEGG   Serratia proteamaculans: Spro_0478Help
Entry
Spro_0478         CDS       T00595                                 

Definition
DNA-binding transcriptional regulator BasR
Orthology
K07771  
two-component system, OmpR family, response regulator BasR
Organism
spe  Serratia proteamaculans
Pathway
Two-component system
Module
BasS-BasR (antimicrobial peptide resistance) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:spe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(528084..528746)
Genome map
AA seq 220 aa AA seqDB search
MKLLIVEDDELLQQGLALALAGEGYACDCAATAAEANALLLTSQYSMIILDLGLPDMDGA
SLLRQWRRQQVELPVLILTARDALEDRVDGLDAGADDYLVKPFALVELQARVRALIRRYQ
GHSDNLMQLDDLQLNLSSQQVYVQQQPVEVTPKEFAILSRLMMRAGQTVNRELLQQDLYT
WQDDLGSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLESSS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgattgttgaagacgatgagctgctgcagcaaggcctggccctggcatta
gctggcgagggctatgcctgcgactgcgcggctacggccgcggaggccaatgctctgctc
ctcaccagtcagtacagcatgattatcctcgatctgggcctgcctgacatggacggcgcc
agcctgcttcggcagtggcgccgtcagcaagtcgagctgccggtgctgatcctgaccgct
cgcgatgcgcttgaagaccgtgttgatgggctggacgccggcgccgacgattatctggtg
aaacccttcgcgttggttgaactgcaggcgcgcgtgcgggcgctgatccgtcgctatcag
ggtcacagtgacaacctcatgcagctcgatgacctccaactcaatctctccagtcagcag
gtttatgttcagcaacagccggtggaagtcaccccgaaagagttcgccatcctgtcacgt
ctgatgatgcgcgccgggcaaacggtcaatcgtgaactgctgcagcaggatctctatacc
tggcaggacgatttgggctccaacacgctggaagtacatatccataatctgcgccgcaaa
ttgggtaaagatcgcatccgcaccgttcgcggtatcggctatcgtctggaatcctcatca
tga

DBGET integrated database retrieval system